CAZyme Information: MGYG000000606_01078

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_01078
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43101.91	6.599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 108783; End: 109937 Strand: -

Full Sequence      

MRTVRRTLMILAGCLAIALSSCEKDDYKKGGLIPGGGEYTPVLLDKVPGRNVVAYCTYYG
KSIPDVNAVTQINYAFAELYVKDGEYKGFKLQGEESRFRQIVDLKKKSSGLKILISFSHT
VVNPDNAQGGGFSKMSSTEAGRKAFAKDCLAFCQKWGIDGVDIDWEMPGVSWSGHACDPM
HDTENFTLLMSQLRQTLGNRYLVTYAGYVKNKVSDDDGSGRYFDLVALKDIVDYVYVMTY
DLDAAPHHHSAIDDPRAYWDWKRTFEEYAKAGFPKEKMIFGVPFYARHSFSENPTAIDYK
KILTLDESLYKIDNWDDKAGCPYISVKASGAFYAGYDNARSIAVKAEWAMTRGMSGLMCW
DYDADDASGTLRTALWNGVMDKRY

Enzyme Prediction     

No EC number prediction in MGYG000000606_01078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	51	370	8.8e-55	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.04e-58	52	365	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	1.54e-52	51	365	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	5.39e-52	52	365	2	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	3.29e-44	70	370	29	346	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	6.54e-37	58	375	55	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY54522.1	5.29e-154	4	380	1	374
QEC44030.1	5.04e-136	15	382	11	371
QQA31286.1	6.55e-120	5	382	3	375
QUT99830.1	6.55e-120	5	382	3	375
QUT62873.1	6.55e-120	5	382	3	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	8.53e-28	65	380	23	343	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6BT9_A	3.11e-27	98	365	145	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
5GZU_A	5.12e-27	94	382	93	394	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	5.67e-27	94	382	344	645	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
3QOK_A	3.03e-26	6	372	5	410	ChainA, Putative chitinase II [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95M17	8.04e-24	103	370	82	370	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
Q91XA9	5.07e-23	51	370	23	370	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
Q6RY07	3.15e-22	51	370	23	370	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
P20533	4.62e-21	100	365	144	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P36362	3.26e-18	59	369	42	379	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000334	0.999714	0.000000	0.000002	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000606_01078.