CAZyme Information: MGYG000000606_01088

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_01088
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		93251.84	5.4488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 122755; End: 125271 Strand: -

Full Sequence      

MKSFRLSLLAAFSLMAVSFQAKAGEWIRINQVGYLPDASKVAVYVSNDVEPHEIPSFSVV
DASTGETVYASRPEDVRNTGVMGELKTTVRLDFSALTAEGNYFIVAGGSKSSVVRISAEA
YDGAADFVLNYMRQQRCGWNPFMRDSCHVKDGYIRYHPTKEGQWIDVRGGWHDASDCLQY
TTTSANAIYQMMFAYQSNPEAFGDEYLADGTPGRNGIPDIIDEIYWGLDWLDRMNPEPGE
FYNQIADDRDHVGMREPAKDIADYGWGKNNGRPVYFVSGEPQQRYNRTNATTGTSSTVGK
FASDFALGSKILAPFYPEFAARIGAKAEGAYQLGIDKPGVCQTASVVSPYIYEEDNWVDD
MELAAVEMYHSTGDAKYLSQAIEYARREPVTPWMGADSARHYQWYPFMNMGHYHLAKDGN
ARVSAEFIRNLRSGIQRTFEKAEGTPFLYGIPSIWCSNNLTTAMLTQCILYRHLTGDETY
KEMEGALRDWLLGCNPWGVCMIVQMPGAEVYPTQPHSFIVNLNLGNTSGGLVDGPVYSAI
FSGLKGVNMEGGINYLDVQPGTMVYHDSTHDYSTNEPTMDGTASLTFPFSAYQMEGAVLK
GVRKDKNGVVSRVNVNEKKVYLVFTAHYSSDDKGYFENFDGVVPVLNTLKAKGAKGSFSP
TGECFRQPRYKAPIKRIIREGHYLSGHSDKHLLLCEGGVSLVSSDSLVRDIRGMEAELER
FGLNKDRFRWMIPPYETCDEASAYVLKGLGYKLVKPTSGLVTGLDWAAEGETAYRSAGSL
VQNIWDFDDKYGLNGAVILVHAMNYPGRAKEDRVYSHLGEIIDGLRARGYSFGTFKEL

Enzyme Prediction     

No EC number prediction in MGYG000000606_01088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	121	587	1.6e-74	0.9880382775119617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	2.85e-60	124	587	2	372	Glycosyl hydrolase family 9.
pfam02927	CelD_N	1.14e-22	26	111	2	83	Cellulase N-terminal ig-like domain.
cd02850	E_set_Cellulase_N	1.33e-22	26	116	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd10948	CE4_BsPdaA_like	3.42e-18	605	834	27	222	Catalytic NodB homology domain of Bacillus subtilis polysaccharide deacetylase PdaA, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis pdaA gene encoding polysaccharide deacetylase BsPdaA, which is a member of the carbohydrate esterase 4 (CE4) superfamily. BsPdaA deacetylates peptidoglycan N-acetylmuramic acid (MurNAc) residues to facilitate the formation of muramic delta-lactam, which is required for recognition of germination lytic enzymes. BsPdaA deficiency leads to the absence of muramic delta-lactam residues in the spore cortex. Like other CE4 esterases, BsPdaA consists of a single catalytic NodB homology domain that appears to adopt a deformed (beta/alpha)8 barrel fold with a putative substrate binding groove harboring the majority of the conserved residues. It utilizes a general acid/base catalytic mechanism involving a tetrahedral transition intermediate, where a water molecule functions as the nucleophile tightly associated to the zinc cofactor.
cd10917	CE4_NodB_like_6s_7s	5.82e-16	618	826	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35459.1	0.0	1	837	1	832
QTO25660.1	0.0	9	837	7	832
QPH59586.1	0.0	1	837	1	832
QUT98069.1	0.0	1	837	1	832
QQA29127.1	0.0	1	837	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	2.15e-47	24	587	15	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	2.00e-30	35	592	2	539	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	4.70e-27	35	592	2	539	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
6DHT_A	4.39e-26	27	585	18	557	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
1RQ5_A	1.13e-14	27	495	7	511	ChainA, Cellobiohydrolase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT3	2.69e-25	27	585	32	571	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P14090	7.92e-25	19	597	333	912	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P23658	3.62e-24	27	590	4	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
Q05156	1.01e-19	19	585	177	735	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P10476	3.48e-18	20	592	31	598	Endoglucanase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000273	0.998945	0.000256	0.000176	0.000168	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000606_01088.