CAZyme Information: MGYG000000606_02248

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_02248
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	MGYG000000606_13|CGC1	49861.33	6.4491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 48199; End: 49542 Strand: +

Full Sequence      

MDRRSFLGRSARIGVGLVGGSVLLSACAGGDKSGKMTPLRQPGEYYVPELPDKAIDGREL
KVGVIGCGGRGSGAVEDLLNAADGIKVTALGDVFADRLTGLRENLKTKWNQEVPEDHCFT
GFDAYKQVIDSGVDMVIVATPPVFRPTHFQYATEKGVHSFLEKPIAVDAKGYRLIMATAK
QAEAKGLSVVTGTQRHHQRPYVESFKRIQEGMIGEITGGNVYWNQGMLWYKERQQGWSDM
EWMIRDWVNWKWLSGDHIVEQHVHNIDVFNWMIGKHPIKATGFGSRQRRVTGDQYDNFSI
DFEYENGVHLHSMSRQIDGCSTNIGECVHGTKGYWSSADFAIRDLQGNVLWQFDFEAEKA
QYKQTNPYVLEHVDWVNHIRKGEAHVEAGECGISSLCGVMGRESAYTGNTITWDEISAAA
LDYLPEKLELGKMDMSKYTVPVPGTGK

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	59	246	1.1e-19	0.45614035087719296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	8.44e-35	57	408	1	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.45e-11	60	185	1	115	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	3.09e-04	104	216	23	145	putative oxidoreductase; Provisional
pfam03435	Sacchrp_dh_NADP	0.003	62	190	1	120	Saccharopine dehydrogenase NADP binding domain. This family contains the NADP binding domain of saccharopine dehydrogenase. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23801.1	7.71e-241	1	447	7	453
BCG53919.1	5.11e-234	1	447	7	459
CDN31231.1	5.30e-225	1	447	5	454
QUT52998.1	8.87e-223	1	444	7	454
BBK93797.1	2.53e-222	1	444	7	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z3B_B	3.16e-07	133	304	63	221	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]
6Z3B_A	3.21e-07	133	304	65	223	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]
6Z3C_AAA	3.28e-07	133	304	71	229	ChainAAA, Gfo/Idh/MocA family oxidoreductase [[Ruminococcus] gnavus],6Z3C_BBB Chain BBB, Gfo/Idh/MocA family oxidoreductase [[Ruminococcus] gnavus]
3MOI_A	7.45e-06	133	222	65	151	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8H2K3	5.39e-08	1	229	3	217	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
Q0HKG4	5.42e-08	1	229	4	219	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1
Q0HWR6	5.42e-08	1	229	4	219	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_1440 PE=3 SV=1
Q8ECL7	9.53e-08	1	229	4	219	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1
A6WQ58	1.26e-07	1	229	4	219	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.000001	0.001696	0.000285	0.998021	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000606_02248.