CAZyme Information: MGYG000000608_01079

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518
• CAZyme ID: MGYG000000608_01079
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42063.9	4.6557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000608	2613041	MAG	Madagascar	Africa

• Gene Location: Start: 4694; End: 5818 Strand: -

Full Sequence      

MDVRQIFSFLLLFSGLAIADPTDASDVVVPDSPPIGKIASVTPLFEHGNGYNIYRIPAIT
CAPNGDLIVVCDGRVDYNDLNGSRKIDIVMRRSSDGGNTWTPCETAFSEGEGKPVSDPSL
VTDRITGELFCFYNFMDQDLSEQEYRLHVRKSQDNGKSWDNAIDITGAITPETWNRDFKF
ITSGQAWQTRDGKILHTLVNLNDNRKGVFLFGSHDHGKSWKRYETLITPADESKFVELSN
GEWMVNSRVNGNGCRYVHRSRDDGKTWESTPDAVLVDPSCNAVVLPYRYQNETKDLDLLF
FCNNNDPVDRKNLTLRLSTDQGKTWTRQQVLDPGDCGYVDMTALPDGTLGIVYETANGCN
FLRFIPEWADQKNN

Enzyme Prediction     

No EC number prediction in MGYG000000608_01079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	44	358	1.8e-74	0.935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.42e-80	42	358	1	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.24e-21	82	351	10	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	4.24e-13	48	334	269	615	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	8.66e-06	152	326	6	162	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
smart00602	VPS10	3.51e-04	213	329	15	116	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXD15092.1	2.67e-108	50	368	43	361
QFZ55957.1	3.78e-108	29	368	17	358
APS40775.1	4.69e-102	54	372	48	366
APQ16737.1	9.43e-102	54	373	48	368
AVR47132.1	1.00e-101	3	354	4	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	1.23e-46	50	368	21	358	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	7.99e-45	50	368	21	358	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	2.78e-44	50	368	17	354	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	5.30e-44	50	368	17	354	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	7.31e-44	50	368	17	354	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	2.01e-45	4	368	13	400	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	4.56e-31	54	356	203	528	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
O35657	4.77e-23	54	350	71	376	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
Q99PW3	4.77e-23	54	350	71	376	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1
A6BMK7	5.06e-23	54	344	77	376	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.999095	0.000155	0.000177	0.000158	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000608_01079.