CAZyme Information: MGYG000000608_01137

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518
• CAZyme ID: MGYG000000608_01137
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000000608_144|CGC1	45064.77	8.937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000608	2613041	MAG	Madagascar	Africa

• Gene Location: Start: 600; End: 1793 Strand: -

Full Sequence      

MTSVQEKQREVWILSGETSGDMYGARLAEALRKEAASRGEKMTVRGMGGGNMRAAGVDLR
VDSTELGVIGVIEVLKHLPVFIRIFFQLRRDMVAARPDAVVVIDYPTFNLMMAKFLKKNG
IPVIWYVSPQVWVWHKSRIYTLAKVCSKMMVIFPFEVEIYTRNTSLATEFVGHPLLDIVE
ERRDPAIQRDDRLIVLLPGSRTMEVTRLFEPMLETALQFYRKHPEFRFVTAVPREKIYRL
SCEIFRKFQEKHPGEELPLKIVCGETAKYQQQATAGIAASGTVTVESAIAGLPLVVVYKL
NYLTILMMAVVVKLFRGFFTMANIIANREVYQEYLQTKVCPEELVPALERIIPGGVRRPY
VEEGMQIVRDELKSQDKSAGERAAEAVFSVIEPHTLS

Enzyme Prediction     

No EC number prediction in MGYG000000608_01137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	12	368	1.7e-98	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.83e-109	13	392	6	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.65e-91	13	392	6	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.31e-71	11	375	1	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.78e-68	13	387	10	382	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.59e-43	61	350	43	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45461.1	2.45e-151	8	392	11	393
QSH40861.1	4.10e-133	4	388	1	383
AKJ65399.1	1.84e-66	13	352	8	339
QHI67954.1	1.99e-64	8	391	2	375
AZR73948.1	1.57e-62	10	395	3	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.38e-38	5	392	3	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.38e-38	5	392	3	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	9.80e-61	11	392	6	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	7.56e-60	7	392	5	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1INL4	7.98e-59	10	392	3	379	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q74AT9	6.46e-58	5	391	3	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
A0L8R9	4.19e-56	13	388	9	379	Lipid-A-disaccharide synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
276	298
303	325