CAZyme Information: MGYG000000611_01059

Basic Information

• Species: Senegalimassilia faecalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Senegalimassilia; Senegalimassilia faecalis
• CAZyme ID: MGYG000000611_01059
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	MGYG000000611_15|CGC1	46768.75	7.9895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000611	2306701	MAG	Madagascar	Africa

• Gene Location: Start: 2676; End: 3935 Strand: -

Full Sequence      

MHASVGSGHRSAANAIAQAFELMRDEQAAEPAESAKQPDVPHIPENLEVKVLDILDFGRI
VFDGDKTASMFTGPTRPVYDLTWRYTFTGRLLWGGGTVWAHIMYPKFVEYVRNRPPAAIV
CTHITAANVAVSARMLTGQHYPIVCVPTDYETEGLWPHLSSDLFCVATESMAETLRPRKV
PEKRIRITGIPTRDDFRRTYDRAETRQRLDLPQNKRIVLALAGAYLPRPYVHFRNALDNL
LPFLHTLGHSLHFVFVAGNDREYAEHLRTQCAELGISDNVTVLEYVEGMAALMAASDLVI
CKSGGLTVTECLCAQVPMILLGKAYGQEKANVRMLTSLGAAMHVTTWRELLDALRHVANN
PDSVRAMLVNGSFLRRPNAARDIAAATLSLADAPKDESDPLYKKHFLHFYWGKKPAHVR

Enzyme Prediction     

No EC number prediction in MGYG000000611_01059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	235	370	3.5e-26	0.8407643312101911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.29e-59	1	392	4	364	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.33e-32	116	391	92	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13609	PRK13609	4.07e-30	137	393	124	371	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	2.21e-28	135	406	119	389	diacylglycerol glucosyltransferase; Provisional
cd03785	GT28_MurG	5.53e-24	177	385	146	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS69492.1	4.75e-236	1	419	60	478
ACV55211.1	1.54e-234	1	419	105	516
BAK44346.1	6.59e-233	1	419	35	465
QTU84801.1	1.61e-218	1	419	44	461
BCS57039.1	8.65e-199	1	419	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.71e-07	264	391	227	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.54e-06	183	383	160	358	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54166	3.04e-22	134	383	121	361	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
Q49WE6	8.16e-20	106	407	95	390	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
Q5HQE7	1.10e-19	106	367	95	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ugtP PE=3 SV=1
Q8CPR3	1.10e-19	106	367	95	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ugtP PE=3 SV=1
B9DQ98	1.49e-19	106	407	95	390	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000611_01059.