CAZyme Information: MGYG000000612_00002

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera
• CAZyme ID: MGYG000000612_00002
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000000612_1|CGC1	39437.52	9.3117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000612	1970930	MAG	Madagascar	Africa

• Gene Location: Start: 968; End: 2017 Strand: -

Full Sequence      

MINLRNKKIIVTFLMHLGDLILITPFLQVLRRHAQGSEITLVVDEKVADVVRYNPNIDHL
VTVDKKGKDNSVRALWHIGRRLHQHHYDILINLHPNERTSFLAAVIHAKQFVGMSHFLVR
PLMDRYTRLDRIHLHAADMYINVLAQLGIDDYRSDGLQFFTCKAWDDKATEFYRSQGVHN
SDALIGFNIGSAVPQKRWPAKRFAAVADYFARRGFKCVFFGGTMDEDMVKEATSQMESDP
IIATGKFTIGELASAIRCCSLFITNDSGPMHVAVSQGVPLVALYGPSNPKLYGPYTDRAI
VLESTNHYEVGKSMKQIIREGNYKGISVIPMSQVIAAGEELLSRYYGRK

Enzyme Prediction     

No EC number prediction in MGYG000000612_00002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	305	2.4e-51	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	4.29e-63	8	337	1	274	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	6.24e-53	7	343	2	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.99e-32	72	324	1	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.21e-29	7	342	6	343	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	1.18e-24	8	342	1	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALG42175.1	5.86e-254	1	349	1	349
AVO27634.1	1.68e-253	1	349	1	349
CCC73399.1	1.68e-253	1	349	1	349
AVO74798.1	1.68e-253	1	349	1	349
AXL20515.1	6.17e-210	1	345	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	6.24e-141	3	342	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	6.26e-26	18	342	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P45042	3.74e-17	76	325	70	322	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	4.40e-16	184	343	182	344	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
Q57336	1.09e-15	7	334	9	334	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	2.01e-15	154	342	163	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.911655	0.087083	0.000597	0.000235	0.000139	0.000297

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000612_00002.