CAZyme Information: MGYG000000612_00266

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera
• CAZyme ID: MGYG000000612_00266
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000000612_11|CGC1	59781.97	9.369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000612	1970930	MAG	Madagascar	Africa

• Gene Location: Start: 15775; End: 17334 Strand: +

Full Sequence      

MKQWFLTHRYGLTVALVAAMILLPFLGAAPLMDPDEPVYGETAREMLLAGDWLSPRIFGQ
YWYDKPPLFYWLEMLSYSFFGVSDIASRLPSVIMAMATTMYVYVQGKELFNKPIAFLSAL
FLVTSAGFMYIGKAAVTDMTLMFTLTVTMVSFYRKKYYIAYIFCGLSLLAKGPVGYAFPA
LIMLIYLAWTRQWPLLKHMKIPQGILLAFLVGLPWYILMYRVHGEVFLDTFIGYHNITRF
AAPEHPGQNSLFFFIPILFAAMMPWTAALFPTIRRLFHKRDPFRDILRFCFVWAAFIFVF
FSLSKTQLVTYIAPMFPPTAYLLGWYWYRCYIERKFSRPLLVSFYILGLLLLASNAIPLH
ENAAFFRPAIAWGSGLLAAALFLPAWCLWRRRYWSAFVAGIVMMVCFSWAAFGFIIPQFK
GHVTSYETAQILPDVYDGHSPLYIEKFLRPGIAYYSGMYGTEWDPVKDPDLEELLAEKDK
IFLVMSKSTFHKLAKSQQLIDRFGIAAETPTQVILINHP

Enzyme Prediction     

No EC number prediction in MGYG000000612_00266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	422	4e-106	0.8037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.48e-57	1	353	1	360	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.27e-37	8	418	5	430	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	7.01e-19	64	215	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	6.69e-12	39	221	35	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	1.61e-04	64	315	86	332	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO73979.1	0.0	1	519	1	519
CCC72524.1	0.0	1	519	1	519
AVO26796.1	0.0	1	519	1	519
ALG41392.1	0.0	1	519	1	519
AXL21031.1	6.06e-254	1	519	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.76e-32	11	372	32	412	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6V1N8	1.20e-31	34	324	30	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q02R27	1.20e-31	34	324	30	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
O67270	1.35e-31	14	320	7	314	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C5BDQ8	3.08e-31	13	405	9	423	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q9HY61	4.06e-31	6	324	1	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000029	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
12	31
85	104
116	138
158	189
201	223
251	273
286	303
308	327
340	359
369	389
394	416