CAZyme Information: MGYG000000612_01589

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera
• CAZyme ID: MGYG000000612_01589
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42055.35	6.767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000612	1970930	MAG	Madagascar	Africa

• Gene Location: Start: 1931; End: 3082 Strand: +

Full Sequence      

MKKPNTKSGIFLALAILVLAAIGAWFFWDRSPSPAGPAGPSKGAVQEDEASRLVAKMSPE
VKIGQLMMIGLAGTTIDDQGQRQLEYCHAGNVILFDRNMDTPEQVQHLTKKIDTTIRKKS
GVMPFIALDQEGGQVLRMRKAFPPVPSEQSIGQSGQPAQAKQWAVTTGDALKKLGINVNF
APVVDLGSQAERSYSLDPGVVTQFAHEAIAGYEQTGIWCSLKHFPGIGKVKTDPHIDGDS
VNSSKDDLMKQDLKPFENLIKSEDNQKMFIMVSNVTFPALDPNLPACVSKPIMTDLLRNT
FGYQGLIVSDDMEMGAMAKHYAFADMGVMAIKAGADMVLVCHEYAHERETYDGLLKEYKS
NAEFRALVDEKVTRIVRTKLNHQ

Enzyme Prediction     

No EC number prediction in MGYG000000612_01589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	340	1.1e-50	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.53e-67	60	377	3	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	4.90e-67	57	381	1	314	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	4.84e-58	68	343	5	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.53e-07	33	379	16	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC72588.1	2.67e-253	1	382	1	381
AVO26856.1	2.67e-253	1	382	1	381
AVO74039.1	2.67e-253	1	382	1	381
ALG41456.1	4.93e-249	1	382	1	381
AXB83100.1	8.36e-160	1	383	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.66e-54	62	379	16	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	5.53e-44	62	351	12	309	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
7VI6_A	1.24e-41	68	343	5	279	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
5BU9_A	6.26e-38	55	379	3	337	Crystalstructure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333],5BU9_B Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333]
4GVF_A	5.52e-37	67	342	4	280	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AF74	8.37e-45	67	360	6	302	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
B4SRK3	1.14e-37	66	342	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2VDM3	2.62e-37	67	342	4	280	Beta-hexosaminidase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=nagZ PE=3 SV=1
B2FPW9	3.08e-37	66	342	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q5QUZ5	3.84e-37	67	352	4	288	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999957	0.000040	0.000026	0.000000	0.000000	0.000013

TMHMM  Annotations     

start	end
9	28