CAZyme Information: MGYG000000615_00743

Basic Information

• Species: UBA1752 sp900554405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UBA1752; UBA1752 sp900554405
• CAZyme ID: MGYG000000615_00743
• CAZy Family: GT84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2349		253632.39	8.2928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000615	1737072	MAG	Madagascar	Africa

• Gene Location: Start: 37450; End: 44499 Strand: +

Full Sequence      

MPKGLRSALKNARREIIARVESGTAPDWVADNCCVIDKYCRAAFKAPLSKHRALRPLISE
LFDERDNYFTASELCEFAESRGIAFSHAEICVLPELIAAEAVLRISDILGSGAGGSAFTL
SGAVRMLMSLSDLNRGELAARLWSAEPVLAAGEPDYERSDAETRAVYREFVARESKKRGE
SEPDTARALIAESNARGELLGQSIVRPPRYAAPLWVCSAAVFSALLIATAAAVLGFYALF
VAPPLAAAGFIAADLLCRHAVKPRPTFRLELDSIPEGGETLVAVATLITDDGWDEITETL
SRFAYATPDTRVSFCLLADHPDSKTQYAPGDGRAAEKARAVIDRLNALHGERFCLFLRER
RLNRSEGRYGGFERKRGAVCELAECIAAGGSAALYGGARFIGGVKYLLTLDSDTRLSVGT
VTELVSAALHPVNRARVEGGRVVSGCGVIQPAVRTSLENAYKTGFTRLISGAGGTEVYAT
AAYARGQTVFGEGVFCGKGLIDVSAFCAVVLGALPCGRVLSHDVLEGAMLHTLYAPETVL
TDSTPKNAVSYYRREHRWIRGDVQNLYFLFRPGLRRLTRLRLLDSVLRALLPLFSAAAMC
FCGFLLHGRGILLFLFSYAYLFLPFAVSVLHSLFVKSPFACLHYFSRVYSELLQSLFRLI
YELSASGRRAFLALNAAFLAAYRSATGRKTLEWVTAAQAERAGAGLGKYALDSAASTLLG
AALLAFAQVSFARFIGLMWFVYPFAAVFLSRPLEGGGPVRARLPERQERVLRAYCADMWR
FYSENVSEATNHLPPDNVQVSPVSDTAMRTSPTNIGFYLVSVLAARDMGFIGTKTLFDRL
EASMETLLSLPKYRGNLYNWYDIRTKEVIGGGYVSFVDSANLTGMLIALKEGLREYIAED
ERAGAVIAQAESLINGIELSAFYDRSRSLFAVGVGSDGRLDNSFYDLKMSEACMGGYIAV
ARGEVPKKHWRALGRPLTHSRGYIGMLSWSGTAFEYLMPRLFLPLWRESFDFESLSFAVM
MQRAAGEPWGVSESGFYSFDAQMHYQYKANGLQKLAMRRCGADENVVSPYSSFLSLPICP
LAAMKNLRRLANRGVYGKYGFYEALDLNGGTGVTVKSYMAHHVGMSMIAAANALSDGVFV
RRFVSDGQMKCALELLQERIPVGAVVFGNSRRLREKRREYTPAAGSAAAGDLKTMLFTRG
DIGFAAGSDGSVSLFYGENAVTRTDFAPFRQDPAPRVVFSRSGGVYSCSPAAGAQNAFLW
DAAGATYVCSSPEFSAKVRLSIAKDCGCVMISTRAEALKKYDITLSFAPVLQRVGEYLAH
SAFSGLFLEAEYDRARRILYFTRRSRRDGTPALTLAVALKDALAECGFVCGSDGFSLGDT
FAPERIARISVGTEAAAFKTPHCIFRALGADGGRACFLLTCGETKRECEMNIRIARGGSG
EERSLRTDEVGSRMLTAILYEKAPRAAARFSLCDIRDLWRHGISGDLPITLIKVKTPALG
RISDIIRAHLVLAKRFFASDTVFLIDDPDRYDRPAERTVRELIRSGGGGEYIGRKGGFFL
LRRGELTPELPDALEECAAEVFDLTRFTRPLERLAAPQGDIRICAGSRVPLPSPPGGVRS
GAGYFTPEGYTEDKSLARGSVYSFVLAGRGLGSVVTAHSLGYTFFGNARERRICAFTGEK
DVAANGERLVLRIDGCDYDACACAGSFSVAPGVVRYGGEINGVEYSVTVFAAHKYPVKMI
RISASRAVESRFLLRPVMGESATPPHTGVECVRAEFSSGAALLFHSPFGQTFSHGFGFAG
VCGGNAAAEAALLSFSGSDAIYYIGACATEQGARTVAAAADAGFYRRESAAAEAFARSLL
PPFNAASGLPARDALFNTFLPYQVGACRFLARAAFYQSGGAYGFRDQLQDCVSLVFSRPE
LVRTHILRCCAHQYEQGDVMHWWHAGAGSVGAGVRTRCSDDLLFLPLVTADYLRVTGDGS
VLGVSVPYVASPPLSAPERYELPARSGVKESVYSHCLRALGQAFRTGAHGLILMGSCDWN
DAFSLVGAAGRGESVFSTLLYILAARAFAPVMRSLGDAAAADGLLARAEALAAAVEKHAF
FGDRYARAFCDDGTPIGVPGGAECEIDILSQAFAALCGLRADRVSAALSAAFDVLYDKDL
RITKLFAPPFAAGGSTEVGYIRGYTPGVRENGGQYTHGALWGAAGCFAAGMDARACAILA
CADPATRCTDKRLAALYGGEPYAVAADIYSGALGGRAGWTWYTGAAAWAHRIMLEMLFGI
RLRAGKLSVFPKTSYEFRLAHPRGVLLITASEALPAGITLDGLPAVFPLALPEGEHRLAV
KVDKPARGC

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	1462	2292	7.3e-155	0.8204633204633205
GT84	943	1146	1.6e-63	0.9906976744186047

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	4.39e-105	1652	2346	306	1056	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	2.60e-69	1873	2281	19	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam10091	Glycoamylase	4.92e-19	943	1138	1	207	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.
cd11753	GH94N_ChvB_NdvB_2_like	9.94e-08	1139	1356	1	235	Second GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This second of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
cd11756	GH94N_ChvB_NdvB_1_like	2.71e-07	1645	1818	35	213	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ23197.1	0.0	120	2342	170	2497
BCI59942.1	0.0	17	2291	51	2420
AVQ95160.1	0.0	98	2322	160	2532
AYF37850.1	0.0	98	2322	160	2532
QCN91406.1	0.0	98	2322	160	2532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CQS_A	6.78e-24	1858	2324	337	821	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACT_A	4.59e-23	1858	2324	337	821	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
3AFJ_A	4.59e-23	1858	2324	337	821	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACS_A	1.04e-22	1858	2324	337	821	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]
3RRS_A	5.20e-22	1859	2292	318	760	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	4.66e-196	271	2297	480	2787	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.38e-22	1875	2291	328	748	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	4.05e-13	1905	2281	356	719	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
219	241
586	608
613	635