CAZyme Information: MGYG000000615_01595

Basic Information

• Species: UBA1752 sp900554405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UBA1752; UBA1752 sp900554405
• CAZyme ID: MGYG000000615_01595
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183		20629.42	5.3912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000615	1737072	MAG	Madagascar	Africa

• Gene Location: Start: 1588; End: 2139 Strand: -

Full Sequence      

MNTKTKIIAVFCIIAVIAVAAVFGYRSYEKRLYPREYADIVAAAAKKNDIPESLVYSVIR
AESSFRAGAVSKAGAKGLMQLMPETYEWLVQKQGGSETPEDITDPEVNIGYGCLYLRSLY
DRFGDWELAVAAYNAGPNRVAGWLADSRYSPDGKRLDKIPYDETENYVNRVFSAKEQYEK
LYY

Enzyme Prediction     

No EC number prediction in MGYG000000615_01595.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	177	2.8e-33	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.88e-65	34	176	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.85e-54	32	181	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.16e-42	52	174	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.05e-37	33	182	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.71e-33	43	154	3	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49510.1	7.37e-53	1	182	1	186
QNK41497.1	3.38e-49	2	182	4	188
CDZ23581.1	1.89e-46	1	183	1	189
CEI72025.1	4.15e-44	1	182	1	180
CED93144.1	5.37e-44	4	182	3	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.17e-23	33	173	445	587	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.22e-23	33	173	474	616	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	5.50e-23	33	173	445	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	5.51e-23	33	173	446	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	1.90e-22	33	178	449	598	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.06e-21	33	178	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.06e-21	33	178	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	4.27e-20	33	178	476	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	5.89e-19	41	174	64	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.00e-14	33	173	1418	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.972911	0.017151	0.005669	0.000133	0.000070	0.004092

TMHMM  Annotations     

start	end
7	25