CAZyme Information: MGYG000000618_01457

Basic Information

• Species: CAG-196 sp900553895
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp900553895
• CAZyme ID: MGYG000000618_01457
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		51905.65	7.3241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000618	1703393	MAG	Madagascar	Africa

• Gene Location: Start: 1072; End: 2418 Strand: +

Full Sequence      

MRERILLFIILSCLGVFLYVFQNYVNTVVGFVILCACMVVYGLYSLAATKYQKRKLKMHP
VVVNENFKPFVTIMIPAHNEESVITNTVENILKMDYPNFEVIVIDDRSSDNTASVIKDLE
AKHEQVRALIREKDAFPGKSAVLNDALKMAHGEAILVFDADATVEPDFLNKLVPNLEPAD
VGAVQARKIIRNKDVNFLTRCQNNEYTFDTYLQVSRDAIKGAVELRGNGELIKRQALEDI
DGWNNYTITDDLDMSTRLHIKGWDVRFCPDACVYEEGIVYVFPLFRQRRRWLEGTIRRYL
EYFGEAMKSKKMSLRARLDMAVYITQFIMPLWFMMEVVFRIIKLLTDKIDPYSLHNVLWS
SLIVSAVVGLGFFGAIRYSLRKYDFVPRMSAFRQALETTVYFLIIWFPMELFICGKILFC
KKDMNWGKTAHGLVVEEQNKQELEMQEV

Enzyme Prediction     

No EC number prediction in MGYG000000618_01457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	292	2.2e-43	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.08e-59	17	431	1	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.98e-52	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.81e-48	69	409	54	383	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	1.74e-38	69	292	2	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	3.07e-37	38	297	2	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	1.40e-203	50	438	6	390
BAZ42219.1	7.03e-76	55	431	95	465
AGY58232.1	1.66e-75	45	431	40	415
BDA68096.1	2.65e-71	63	431	100	463
AFY31884.1	3.17e-70	59	431	97	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	5.94e-17	43	311	19	276	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	6.00e-17	43	311	20	277	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	1.14e-10	69	300	128	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.19e-10	69	300	140	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.19e-10	69	300	141	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	8.00e-66	69	431	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	8.54e-65	69	431	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	5.88e-58	69	437	108	472	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	1.11e-27	65	311	43	296	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q5HKQ0	4.76e-27	71	314	49	290	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
320	342
357	379
400	419