CAZyme Information: MGYG000000619_01655

Basic Information

• Species: CAG-873 sp900540625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900540625
• CAZyme ID: MGYG000000619_01655
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	MGYG000000619_45|CGC1	64676.56	10.1071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000619	2509514	MAG	Madagascar	Africa

• Gene Location: Start: 6330; End: 8057 Strand: +

Full Sequence      

MSKIKTQLIAAAVAAILGTTASSAALTVRSIAADTISADNIVVPESFEIDTHKMMQNWYL
TNYAVLDRNADRRANVPTTDREYIDRLQRMPTVMEMPYNKIVRAFIDMYVERKKSLVESM
LGMSLYYMPIFEQALDKYGMPMELKYLPIIESALNPTAVSRAGATGLWQFMLDTAKGMGL
EINSLVDQRRDPYLSSDAAARYLKQLYNSYGDWSLAIAAYNCGPGNVNKALRRAGGGKKD
FWEIYPFLPRETRDYIPAFIAANYAMTYYNHHNISPALASRPIVTDTVHVNKRVHFRQIS
DVMGISMDELRVLNPQYRTDVIPGDIHPYALILPNIQAYCYIANEDSIVNHNAELYARRD
VVEPSTGASITSEDGGQYIEEVIVKYHKVRRGENLASIARRYGVSQQSIRRTNGIGRRVR
RGQTLRINTVQRRYVPAPAQTDSTTTDNKPQVAVPDTKADTTPVAKTDETVEPTPQTRQV
TDAMSNAKNNDKKNDNGRKNSRKKTESKPVKHKVSSGENLTKIAKRYGVTVEQLRSANNI
SGDDIRAGQTLTIPSKDVKSDKKSSSKKKSRRRRR

Enzyme Prediction     

No EC number prediction in MGYG000000619_01655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	130	265	3.7e-25	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.00e-68	135	264	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.30e-50	94	553	72	446	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.95e-35	131	240	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	5.77e-26	125	266	4	148	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.85e-26	151	265	11	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR10036.1	7.40e-186	36	554	30	546
ANU62627.1	7.40e-186	36	554	30	546
QIM10870.1	2.40e-150	36	556	34	541
BCI63615.1	1.17e-148	34	553	29	506
QCD38174.1	5.35e-144	34	563	30	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.80e-06	158	284	481	603	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.82e-06	158	284	482	604	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	4.82e-06	158	284	481	603	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.91e-06	158	284	510	632	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
2MKX_A	6.18e-06	512	553	7	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.31e-26	94	427	69	384	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.31e-26	94	427	69	384	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	2.32e-11	132	265	65	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.94e-06	155	281	1451	1567	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.94e-06	155	281	1451	1567	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008699	0.989186	0.000959	0.000545	0.000300	0.000273

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000619_01655.