CAZyme Information: MGYG000000620_00762

Basic Information

• Species: Parolsenella uli_B
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella uli_B
• CAZyme ID: MGYG000000620_00762
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000620_15|CGC1	39694.81	5.6755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000620	2212641	MAG	Madagascar	Africa

• Gene Location: Start: 1761; End: 2858 Strand: -

Full Sequence      

MLGTRSTGEGKRPAERHDDAERPRALHGVNLSGWLVLEPWVTPSLFAGAGAFDEATLANS
MESARYASMLARHRETFIIERDFASISARGFDTVRLQVPWFVFGEKGPMPGPSAGCLSYV
DSAFDWAEAAGVSVLLDVASAPGADPSSPTSFFGEVESFRMAMLDVVGALAARYADRSNF
CGIEPIDEVRGRSRKGLSVTEGVPPHLLRNFYRDAYEVVRSCAGERPVFVVHDAGIPGAW
RAFMSPSRYVNVWLDGHIYHYSESMNAAGPTGVRRLVDDSAAYLACARKSGLPVMVGEWS
AALPLADAGMTPEGRIALERVFTAGQLSTFAGSAAWFFQTWKTEARLSSWDARVALSSFE
RGMFD

Enzyme Prediction     

No EC number prediction in MGYG000000620_00762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	72	319	2.6e-43	0.8708609271523179

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.06e-20	24	344	16	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	2.59e-202	24	365	19	360
BCV19183.1	1.95e-132	24	365	4	347
ADK68544.1	5.20e-130	24	363	4	345
AKT48931.1	6.67e-128	24	363	4	344
SDR87855.1	1.97e-127	24	363	4	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	8.24e-34	26	299	3	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.83e-33	26	299	3	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	3.24e-21	26	344	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	6.00e-21	26	344	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	6.27e-21	26	344	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CRV0	6.44e-32	26	358	42	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
A1D4Q5	2.38e-31	26	358	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
Q0CR35	3.29e-31	26	358	40	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
B0XN12	3.29e-31	26	358	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	1.19e-30	26	358	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991946	0.007687	0.000321	0.000022	0.000009	0.000047

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000620_00762.