CAZyme Information: MGYG000000621_00329

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000000621_00329
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000621_5|CGC1	36256.61	4.4344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000621	3027354	MAG	Madagascar	Africa

• Gene Location: Start: 47873; End: 48814 Strand: -

Full Sequence      

MVTADSKATKEARELLQYLHTVAGKQIITGQHTQTIPCEEITYIRENTGKEPKLRGFELL
AYSPNINYEDASPECLKEVEENKGTVETALQWARTNRSAGILTFSFHWFSPIGGRDKSFY
AEHTDFDATKVLQEGTPERTAFYADMDVIADILQRFQDENIPILWRPFHESYGTWFWWGA
KGAEVARDLYRLMFDYYTGEKNLHNLLWVWNCDIEENYPGDAYVDVVSIDVYLPEYQSTD
YADAYEKLVAATSRDKVAALAEIGYLPDIDLLQKSRIPWAYYMTWSKEFCIGEQYNSVEN
LKKMYDSEYAVTL

Enzyme Prediction     

No EC number prediction in MGYG000000621_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	313	8.6e-96	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	7.00e-53	5	312	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.12e-15	119	265	137	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.72e-217	1	313	6	334
CBK82137.1	1.21e-159	4	312	5	311
AEB13973.1	2.30e-154	3	313	4	310
AZK45707.1	1.56e-126	7	313	10	314
AOZ93051.1	7.02e-126	8	313	14	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.83e-60	5	312	8	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.55e-57	8	313	150	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	5.79e-50	12	313	43	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	3.43e-42	8	285	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	7.58e-38	1	312	21	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.51e-57	8	313	179	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	6.75e-56	7	313	32	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.13e-51	4	312	147	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.37e-49	5	313	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	7.33e-41	7	313	161	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000621_00329.