CAZyme Information: MGYG000000621_00593

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000000621_00593
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	MGYG000000621_10|CGC1	53722.74	5.1701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000621	3027354	MAG	Madagascar	Africa

• Gene Location: Start: 28140; End: 29552 Strand: -

Full Sequence      

MFRRNFLFGKDSDTANVIDISNDDLYRPDRGYGFVIEQNRREQEALKIPELNSAFDTMYW
YKDRNITFLREDENGCYIDSGEIVTELEEQSGEKMPGRPRRIPLIFKVNVPRQGNYKLTI
KISSEEPMGEVLIFTGRRRLGFHGNVGTGEFTYTMTTNVCDIVPSGQTHIFVDTTVDLTI
LADKPRITGLTVEEMNCPTVYLAGDSTVTDQPGDYPYYPGTCYCGWGQMLSAFLNTRLAV
SNHAHSGLTTDTFRKEGHYAVIEQYTRPGDYIFFQFGHNDQKLPELQAKGGYQANLSRYI
KEAQAKGAYPVLVTPIARNTWRLRDRTYLDLLSEFAAVCKELGEKYDIPVLDLHKHSMEY
VLEKGLQDAKPIFFPGDYTHTNDFGAYQMAGYVAEEIRRVCTNHSERAYRMLAECVTDGF
GAWIPTEENIVPKKPRLYKDIPDPQGNQVLLSEAEQLERVVRLCLKEELL

Enzyme Prediction     

No EC number prediction in MGYG000000621_00593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	199	397	2.1e-53	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	4.29e-71	198	397	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd00229	SGNH_hydrolase	3.19e-15	200	395	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
COG2755	TesA	5.05e-13	196	398	7	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	1.60e-12	204	392	3	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	1.46e-10	204	395	8	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM03704.1	1.14e-287	1	470	1	470
APC40119.1	1.37e-105	1	400	1	393
QKS48637.1	4.33e-65	1	399	1	378
ASA21604.1	2.40e-61	103	443	83	415
AOZ96642.1	1.02e-47	73	397	17	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	1.42e-26	200	400	8	215	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	4.91e-26	200	400	5	205	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000621_00593.