CAZyme Information: MGYG000000621_01197

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000000621_01197
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		41109.96	4.846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000621	3027354	MAG	Madagascar	Africa

• Gene Location: Start: 17879; End: 18955 Strand: -

Full Sequence      

MLQRPLDYAKASMDTMMRKWDAPKLPPEGRFHYHQGVFLSGMYKSYELCKEEKYFEYIKR
WVDAVITEDGVIKQADMGQFDDMQPGILLYPLYHRTHDAKYKKVLDALMAAIDCYPKTPE
GGYFHKADLPEEMWLDGLYMEGPLRAQYGAEFGHPEYFDEIIFQALTMQKHTRDPKTGLL
YHAWSYDKKVEWADKETGCSPEFWGRAMGWVPVALLDELDFIPEDHPDRVKLEKMAVDLL
KSLLAFQSEDGRWYQVVDRGDDPADWLENSCSCLYVAALCKAVRKGLLDASYLAYARKGY
EGVIRSLTWEGDDLIIGNVCVGTGVGDYAHYIHRPVSANDLHGVGAFLLMCEECEQVL

Enzyme Prediction     

No EC number prediction in MGYG000000621_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	355	3.2e-104	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.44e-107	4	355	7	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.55e-102	8	358	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	2.71e-160	6	358	6	359
ANY68695.1	2.17e-144	5	353	10	359
AFC29184.1	4.52e-144	5	356	10	362
AEI40556.1	1.83e-143	5	356	10	362
QNK55786.1	2.34e-143	2	353	7	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	6.88e-111	2	355	10	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.01e-110	5	355	3	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.09e-76	8	355	4	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	2.30e-26	31	352	65	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	1.27e-23	117	348	183	404	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.77e-110	2	355	10	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.86e-21	143	353	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.86e-21	143	353	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	5.43e-08	134	353	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000621_01197.