CAZyme Information: MGYG000000621_01455

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000000621_01455
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35956.43	5.4563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000621	3027354	MAG	Madagascar	Africa

• Gene Location: Start: 233; End: 1165 Strand: +

Full Sequence      

MERFQTGRFHAVNFAVFPHRGVLGAEKTKNSLKEMVRRTHANWVIFTPSGIQETPYSEEI
RWDSNKSCTDEELCSMIRYAQELGLKVALKPTVNCDNGVWRARISFFDHDVPCEPKWGNW
FESHIAFQKHYAEIARRTGCELFLAGCEMTMTEHRETEWRRLIAEVRKVYDGPVGYNCDK
YGEDHITWWDAVDVIASSGYYPIGDWENQLDRIEKVIKKYQKPFLFSEAGCMNIRGSAQV
PNNWELQGGEDDAEQADWYRTMFATCRKRDWVNGFGIWDWPADLEYLSPYAVSGRPAEAV
IAEAFGNRFA

Enzyme Prediction     

No EC number prediction in MGYG000000621_01455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	10	302	2.7e-99	0.9901960784313726

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19606	GH113-like	4.83e-104	11	305	4	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.
cd19608	GH113_mannanase-like	5.70e-82	7	305	1	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02381.1	7.09e-204	1	307	1	307
AXB29271.1	3.60e-164	9	305	7	303
EDP22100.1	6.90e-162	9	305	7	303
CBL01979.1	7.64e-159	9	305	7	303
CBL10421.1	3.89e-131	12	301	7	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YLH_A	1.79e-113	20	308	15	309	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
5YLI_A	1.45e-112	20	308	15	309	Complexstructure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLI_B Complex structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLK_A Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLK_B Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLL_A Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5YLL_B Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5Z4T_A Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112],5Z4T_B Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112]
7DV7_A	3.33e-95	25	305	54	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DV7_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVJ_A	2.68e-94	25	305	54	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVJ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVZ_A	4.34e-93	25	305	54	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVZ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000621_01455.