CAZyme Information: MGYG000000622_00408

Basic Information

• Species: UBA636 sp900546285
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; UBA636; UBA636 sp900546285
• CAZyme ID: MGYG000000622_00408
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000000622_7|CGC1	55808.78	4.9352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000622	1753240	MAG	Madagascar	Africa

• Gene Location: Start: 2208; End: 3632 Strand: +

Full Sequence      

MTDKFLWGGATASYQCEGAWNEDGKGLSNWDYFFHNTEKGKGLVSGDIACDFYHHYKEDI
RMMKESNQNTFRMSLSWPRIFPNGHGEINKEGVEFYHNVFKELRSNGIEPMITLYHWDLP
LSLDEKGGWLNIETAKAFAEYAKFCFDEFKDEITLWSTFNEPYYSLQCMYLAGNYPPNEK
DASKFYKAGYYQLYASALAVIEFRKGKYPGEIGLVADIHQCYPKDDSEECKKALHLADNF
LNNWVLDTIIKGSYPQDYIEFLSKDYDLSYMKNEHEEVFKKGVVDFVGINYYNSFLIQPY
TSGETEILVNNSGIRSSSVKESSEGKKMLVVKGMFERIENPNVERTDWDFEVYPEGIYDI
LMMFKEKYNNITTYITENGLGVREELQEGKTINDQYRIKFMDDHIRELLRAKKEGANVKG
YYVWSSMDLYSWINGTVKRYGLVYVDFDKDLKRYPKQSYYWYKDFIKKYQEENE

Enzyme Prediction     

No EC number prediction in MGYG000000622_00408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	468	2.4e-154	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.56e-175	3	466	6	450	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	9.94e-172	3	468	7	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.04e-157	5	463	9	460	6-phospho-beta-galactosidase; Provisional
TIGR03356	BGL	5.93e-154	3	462	2	426	beta-galactosidase.
PLN02814	PLN02814	2.81e-95	5	467	32	481	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA01557.1	2.48e-196	4	466	3	460
BBK62979.1	4.48e-171	1	466	1	454
BBK23237.1	4.48e-171	1	466	1	454
QNM14238.1	3.77e-169	4	466	5	455
BAK93861.1	1.11e-168	1	466	1	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	7.80e-133	5	467	15	446	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
5YHS_A	3.32e-119	5	466	7	462	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)],5YHS_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)]
4PTV_A	4.56e-119	3	472	9	450	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]
3TA9_A	5.51e-119	3	472	15	456	beta-GlucosidaseA from the halothermophile H. orenii [Halothermothrix orenii H 168],3TA9_B beta-Glucosidase A from the halothermophile H. orenii [Halothermothrix orenii H 168]
5YIF_A	2.66e-118	5	466	7	462	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)],5YIF_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97EZ2	7.96e-117	3	463	6	458	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
C7N8L9	2.59e-113	1	463	5	459	6-phospho-beta-galactosidase OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) OX=523794 GN=lacG PE=1 SV=1
Q4L868	2.22e-109	1	464	4	461	6-phospho-beta-galactosidase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=lacG PE=3 SV=1
P67768	7.23e-108	1	464	5	462	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain N315) OX=158879 GN=lacG PE=1 SV=1
P67767	7.23e-108	1	464	5	462	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000622_00408.