CAZyme Information: MGYG000000623_01103

Basic Information

• Species: Blautia_A sp900763175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900763175
• CAZyme ID: MGYG000000623_01103
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
889	MGYG000000623_27|CGC1	100598.15	4.9497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000623	3121730	MAG	Madagascar	Africa

• Gene Location: Start: 5583; End: 8252 Strand: +

Full Sequence      

MITIKKIYMDYETAPVGVSHMPQFSWELGSDKKNVKQKSYQLQIAKDEAFQDLIFDSGKV
ESEESAHVYVQGASLENGKRYFVRAKVSDGQDESEWSQTASFVTALAGEKGEWEEGAPVW
KAPFVSAETDDSYKSVSKGTYVRGTFEIKKEVKEAYAFTTALGLYQFYLNGEKVGEDEMT
PGWTSYRRHLLYQTYDITKYLQKGINGAGAMLAPGWYKGVMGLTKARNNYGDQTAFTMEI
LVRYADGTTETICTDRSWRGCDSPVVFAEIYDGETYDAALEIPDWSKAETPSGNWKPVHL
VFFDTQVMRAQYGAKVHVMDRIPAKQIFQTPAGDTVIDFAQNMAGRIEVTASGKPGDVIE
LHCFEVLDKDGNVYLDNLRAAKATMKYTFAREETVTWHPTFTYMGFQYALIVSYPGEPKV
ENFTACTLHSDMASNGKLECSNPLLNQLHHNFLWGLKSNFLDVPTDCPQRDERLGWTGDA
QIFCRTATYLMNTYTFYKKWLRDLEVDQTPEGGVPHVIPNIEEGRTDGNWLLSQGPHSAA
AWADAAVINPWTLYLMYGDKAILERQYKSMKGWIDFMRAHAVDYIWNYKLQFGDWVALDA
EEGSYFGATPNDLTCTAYYAYSTGLFAKMAKALEKEEVAAEYEALYHKIVKKFQETFFDA
EGNMTAQTQTAHIVALYFQLTPEKYIRKTVEGLKHLLDKENGHLVTGFVGTPYFCHALSQ
NHCLKEAYDLLLKEDFPSWLYQVKKGATTIWEHWDGMKDDGSMWSADMNSFNHYAYGAIG
EWMYRAMAGIEADPEQPGFKHAVLYPRIGGNLKYTEGNYHSVYGNVGVKWETDGNQVTLT
VEIPVNTTAEIRLDQAKAVKENDGLVFTAAEDYMYAEAGSGTYRVVFEQ

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	327	853	1.7e-174	0.998015873015873
CBM67	135	299	3.4e-31	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.61e-128	436	787	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.28e-61	150	320	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.90e-28	329	429	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.28e-15	789	853	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd14188	STKc_PLK2	0.005	612	703	22	124	Catalytic domain of the Serine/Threonine Kinase, Polo-like kinase 2. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PLKs play important roles in cell cycle progression and in DNA damage responses. They regulate mitotic entry, mitotic exit, and cytokinesis. In general PLKs contain an N-terminal catalytic kinase domain and a C-terminal regulatory polo box domain (PBD), which is comprised by two bipartite polo-box motifs (or polo boxes) and is involved in protein interactions. There are five mammalian PLKs (PLK1-5) from distinct genes. PLK2, also called Snk (serum-inducible kinase), functions in G1 progression, S-phase arrest, and centriole duplication. Its gene is responsive to both growth factors and cellular stress, is a transcriptional target of p53, and activates a G2-M checkpoint. The PLK2 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ94810.1	0.0	1	889	1	880
ASU30025.1	0.0	1	889	1	880
ANU77224.1	0.0	1	889	1	880
QBE96168.1	0.0	1	889	1	880
QJU17155.1	0.0	1	889	1	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	5.13e-173	92	884	274	1027	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.28e-160	2	853	2	846	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	8.21e-141	10	889	38	943	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.99e-172	92	884	274	1027	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.00e-159	22	860	55	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.13e-152	22	850	51	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.26e-107	6	857	34	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000623_01103.