CAZyme Information: MGYG000000626_00668

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_J
• CAZyme ID: MGYG000000626_00668
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		33056.75	7.9835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000626	2453643	MAG	Madagascar	Africa

• Gene Location: Start: 28578; End: 29429 Strand: +

Full Sequence      

MSRVCKCYLKKYLLLVLVLALAAGILIAPDTTEAGVSKEKKDYGVFLSIDSSQMKKLYPY
RLVVIDAQFFSAEDIRTLHKKGVKVYTYLNVGSLEDFRDYYKEYEHLTIGAYENWEEEKW
IDVSDKDWQSFIGKLSKKLHKKGVDGFFIDNCDVYDYAATRESFGGLVRILRNIRSLGAE
LVINGGDVFVTKYRNTYGSAQDIMTAVNQESVWSSIRFDQETFGKQTKETRDYFSDYVKQ
CQKDGMEVYLLEYTKDKKLIRQIRQYCRKNKFHYYISDSIELD

Enzyme Prediction     

No EC number prediction in MGYG000000626_00668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	62	278	5e-60	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03537	Glyco_hydro_114	7.89e-21	63	156	20	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG3868	COG3868	3.57e-17	60	176	80	196	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
COG2342	COG2342	4.21e-13	59	264	43	262	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	4.14e-04	75	169	64	169	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06595	GH31_u1	0.010	75	152	78	156	glycosyl hydrolase family 31 (GH31); uncharacterized subgroup. This family represents an uncharacterized GH31 enzyme subgroup found in bacteria and eukaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	1.29e-146	1	283	1	283
VCV23723.1	1.83e-146	1	283	1	283
CBL11057.1	1.83e-146	1	283	1	283
AOZ95737.1	2.83e-91	10	282	7	285
QHI71547.1	2.72e-88	16	283	5	272

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.346730	0.646560	0.005678	0.000373	0.000293	0.000355

TMHMM  Annotations     

start	end
12	29