CAZyme Information: MGYG000000630_00587

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister
• CAZyme ID: MGYG000000630_00587
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000000630_14|CGC1	65731.26	9.1364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000630	2325548	MAG	Madagascar	Africa

• Gene Location: Start: 10143; End: 11879 Strand: -

Full Sequence      

MKRKNKLHETAAESSRKEVGKTLLFFFLAAFLFLLWGSWLLPVTDPVESNYALTAKEMVQ
SGNWMSPQIYGTYWYDKPIMVYWLLSISYTLLGFTDLASRLPSVICGALSVTLLIWYVQR
ILKDNVTAVWSGAMLALSLEFWVISHAIITDSILLLFTIPTMLSGYMGVMEGNKKHLAAA
YAAAGLACLTKGPVGLVLPGALLLLWCLSMKSGKMAVRLFPWQGILVFLAVTLPWYVGMY
LIHGSDFIEQFLGLHNFIRATSSEHPADNHWYYYLVLLPAALLPWTFTSFYEMVKGWKEK
TPFYRFLMVWCWGTLLFYTLMATKYVTYTYIAVVPAIIFSALAAPAIRQGESHPFLAGLG
GFVLFLAAAIAGSLYIKEGSWWILYVVILYALWSLGIRYKKSRGRRLTVMAAVTASVFLC
LIMEGLPHYLPRRSAVELAEEMKAAPGEHYFFRSYPAGYTFYTGEIATRVVPPPIGDDGE
GRNPLWNEKYVMPSAADKDFVISHRHPEKPVFLYVSKSDRKYFDQWFFKYRFKQVKPLLT
GAIFIMTDAKDIPESFKEAKEQMKKDMKEDLNESPEND

Enzyme Prediction     

No EC number prediction in MGYG000000630_00587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	21	444	8.2e-88	0.8277777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.90e-38	36	421	23	420	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.27e-12	46	395	31	397	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.87e-12	76	235	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.92e-05	39	243	23	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	4.03e-263	2	548	8	552
AOH39318.1	6.27e-188	21	552	10	542
SNV75245.1	2.11e-121	27	525	11	515
AXB83023.1	1.11e-120	28	493	12	484
AXL21032.1	3.44e-118	25	498	7	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.10e-17	43	337	54	356	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	4.00e-23	21	330	3	296	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q6D2F3	4.82e-23	27	372	17	369	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	6.43e-23	23	372	13	369	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
B4TBG8	8.25e-23	45	350	30	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
A4WAM1	1.13e-22	45	328	29	316	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000005	0.000031	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
72	94
101	118
128	145
152	169
184	206
219	241
271	290
303	320
325	347
354	376
380	397
409	431