CAZyme Information: MGYG000000630_00866

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister
• CAZyme ID: MGYG000000630_00866
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000000630_29|CGC1	43853.68	7.9597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000630	2325548	MAG	Madagascar	Africa

• Gene Location: Start: 3612; End: 4790 Strand: +

Full Sequence      

MNLLLADLHKFVGYSGGIEHVLSRMAFAMEEKGYHVSVVMADEKEGASFYPFPEDCHFYN
LFHMPGMKPVHMGALGKGLREVTRLFSKEGARNRNYKMLSAAAPQMEKVLALEKPDVIIS
FREPTGRLLLEGLSTTVPVISMLHNDPNEIFAHAPAKEIKALEKSARIQALMPSFIQKAE
KYLHYDHFVYIPNAVSIPAVSARPGANRKIHTITNVGRVTGRTKRQHLLVEAFTLLAKDF
PDWQVCLWGDTYDKTYVATLKGMIKKAGLESRVLLKGTTKDMASVWKETDIFAFPSHHEG
FPLALTEAMGVGIPAVGYRSCPAVNELIHDGEDGYLTEDGAAPFAEALRKLMEDGDRRTA
FGKRAKENMKPFAPEVVWDEWDRLIREVHGKG

Enzyme Prediction     

No EC number prediction in MGYG000000630_00866.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	210	361	1.9e-28	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03820	GT4_AmsD-like	3.13e-74	3	382	4	350	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	5.83e-41	11	368	4	341	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd04949	GT4_GtfA-like	8.12e-38	106	381	48	328	accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.
cd03801	GT4_PimA-like	4.18e-36	8	386	6	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	1.11e-31	108	380	75	356	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25208.1	6.42e-192	1	387	1	387
QTV78197.1	1.64e-97	1	391	1	392
BBK25901.1	2.68e-97	1	388	8	404
SNV52173.1	4.01e-92	1	388	1	388
AEB99367.1	6.58e-91	1	387	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	1.98e-09	128	388	107	375	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
7EC2_A	2.59e-09	116	389	219	494	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
5E9T_A	8.09e-09	180	388	288	500	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_C Crystal structure of GtfA/B complex [Streptococcus gordonii],5E9U_A Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_C Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_E Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_G Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
4PQG_A	8.18e-09	108	388	214	508	Crystalstructure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4],4PQG_B Crystal structure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4]
5N7Z_A	7.59e-07	193	341	163	310	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9L1I4	8.55e-20	191	388	192	384	Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO2592 PE=3 SV=1
O05083	1.28e-15	12	385	11	353	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
C4LLD6	2.40e-10	213	389	254	431	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717) OX=645127 GN=mshA PE=3 SV=1
P39862	3.45e-09	216	391	203	380	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
P42982	1.08e-08	128	388	105	373	N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=bshA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000630_00866.