CAZyme Information: MGYG000000630_00956

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister
• CAZyme ID: MGYG000000630_00956
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000000630_34|CGC1	51234.95	9.0896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000630	2325548	MAG	Madagascar	Africa

• Gene Location: Start: 12029; End: 13363 Strand: -

Full Sequence      

MLKKLAAALIIAAIPALALGEGPAAVKMKGSDFKNFNAYEVDGTFYTAPLVLTKGGKWKL
SWEKDRLYVYTTPPAMKREEKVEIPYREIEGNKYVDFSFFSGQAGLEYTYKPKKKELTVK
KKKEKKEGKEKALPAERPLVLWDINYSFRNENSDFAALSGTHILSPTMGSYEDIEKGAYS
WNFDYLKRARENSMEVMPLIHNDFEVKKTSLFMHDGKRQEAFISKIAALSEVYGLYGYNM
DFENMDPKDKDLFTDFMKNLSVPLHEGKKKLTADITVYNAGSPTWSLCYDRTKLADFCDY
EIIMGYDETPRTSPYAGSVSSYSWLDRSIQKLITMVPPEKLILGLPFYTRIYEGNPGHMK
SKVLAMKDQEDLMNRYRLKPIWQPEARQYTLTWKQGGLMHRVYLEEEKSLSAKLELEKNY
NLAGLAFWRYGFEKKGIFEELGKH

Enzyme Prediction     

No EC number prediction in MGYG000000630_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	154	434	1.5e-32	0.8513513513513513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	4.64e-55	142	441	3	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.45e-35	155	441	137	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	2.75e-19	144	428	26	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	3.26e-16	144	428	29	329	Glyco_18 domain.
cd02875	GH18_chitobiase	1.38e-14	203	428	85	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25116.1	5.91e-133	2	441	5	440
BDA10778.1	4.93e-64	135	443	35	344
QIB60827.1	2.71e-63	135	443	35	344
QIB27337.1	1.55e-60	142	441	246	549
AYO32308.1	2.78e-59	140	439	216	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.32e-16	223	429	100	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	2.39e-16	194	431	170	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	4.74e-15	150	441	26	335	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4WIW_A	2.18e-12	195	444	75	347	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4S3K_A	9.67e-10	189	433	163	415	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.49e-23	186	443	77	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	2.19e-19	180	352	46	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O05495	5.10e-16	223	429	192	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.29e-15	194	431	169	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	4.18e-14	194	431	169	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998793	0.000223	0.000218	0.000212	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000630_00956.