CAZyme Information: MGYG000000631_01493

Basic Information

• Species: Prevotella sp002299635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002299635
• CAZyme ID: MGYG000000631_01493
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		42607.4	8.6915

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000631	2636006	MAG	Madagascar	Africa

• Gene Location: Start: 252; End: 1391 Strand: +

Full Sequence      

MLKTNKKLAIAALAVTMAAPVNVLSQTRSEWNVPSAQYPMIDSEQRATIKIDAPKASDVK
AMVAGKTYPMTRDANGSWSVTTDPLAVGFHYYFLDIDSVRVTDPGTETFFGYSRLASGLE
VPEGEEGDYYRPHRDVNHGQVRRVQYYSESSQAWREAVVYTPAEYDTNVKKRYPVLYLQH
GMGEDGRGWTKQGRMQNIMDNMIASGKAVPMIVVMESGDINIPRKEGLSRNVEESPYGKS
FYPVMLNDLIPMIDKTFRTKTDRESRAMAGLSWGGHQAADIVFPHLDKFAWLGLFSGAVY
GLDANKNYGGVLKDKDKVNTALKYFFIGCGTEESIGVPKLTKTLDEAGIRYDRFTSHGTG
HEWLTWRRCLRAFITRVFQ

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	148	375	5.8e-53	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02858	E_set_Esterase_N	2.02e-33	45	122	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	6.59e-25	111	379	42	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	8.49e-15	45	122	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	4.57e-11	159	300	12	146	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.26e-08	159	377	39	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29252.1	3.82e-151	34	379	66	409
QUR44906.1	7.70e-149	32	379	289	637
QIU93951.1	7.70e-149	32	379	289	637
QNL40592.1	1.54e-148	32	379	289	637
QUT78598.1	2.18e-148	32	379	289	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	2.61e-106	32	379	33	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	7.68e-91	27	379	7	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.51e-90	27	379	28	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	8.53e-90	29	379	32	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6RZO_A	1.52e-86	32	379	10	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.29e-137	29	379	319	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	7.24e-74	32	379	388	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.34e-51	33	379	34	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	2.28e-27	117	374	27	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P0C1D7	5.71e-06	162	297	127	251	Protein PS1 OS=Corynebacterium melassecola OX=41643 GN=csp1 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.998929	0.000231	0.000197	0.000178	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000631_01493.