CAZyme Information: MGYG000000632_00781

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000632_00781
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000000632_49|CGC1	38613.25	7.8301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000632	2314202	MAG	Madagascar	Africa

• Gene Location: Start: 7355; End: 8413 Strand: -

Full Sequence      

MKILIVSLRYLGDCLLAAALAPAIKEKLPDAQVDLLTFKDNRGILEGISAIDNVIGVEHH
PNKFRQALDHIRSWNSYDWALSTMNSTRCTFYSWSSAKHQVMPQTFNKTKDLWIHLLISK
FVPWAPGHMLDTFTALAEPVVGSIPPLKPVAPDAPLSDDLSQLLAPLGDYVVCHPCSRYQ
DKNWSKNEWQKLFGKILESGKGICLTGGPSAFERDYISEISAGFPSDKVVSIAGKASFGQ
TGRLIRNACAFVGVDTATAHVAAATGTPSFFLFGPTSARVWGPSPKDGRPAHFSGLQDIQ
TVLNVTIIRQDQPQPCDGCSNHRCAHFDPPELSRCMQSISAEKVWRALSNVL

Enzyme Prediction     

No EC number prediction in MGYG000000632_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	68	324	2.7e-32	0.9377777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.65e-29	1	352	2	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	2.61e-25	2	350	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	4.55e-21	2	283	7	298	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	4.12e-16	122	283	58	219	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	3.46e-05	160	276	170	282	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55162.1	9.35e-184	1	352	1	354
QQS89237.1	3.42e-130	1	348	1	348
BBF22595.1	1.72e-98	1	352	28	375
SMB21115.1	1.01e-48	2	352	21	373
QEI07449.1	2.30e-48	2	352	11	373

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	2.69e-22	8	283	1	286	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	6.00e-21	8	283	1	286	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P45042	1.02e-07	1	283	1	297	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000632_00781.