CAZyme Information: MGYG000000632_01397

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000632_01397
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000000632_149|CGC1	39988.53	5.1438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000632	2314202	MAG	Madagascar	Africa

• Gene Location: Start: 1481; End: 2554 Strand: +

Full Sequence      

MKKTLLMSVFAAALALQALPANAWKLWDDFKASNIETARVVDYSDSRRITTSEGQSYALF
FALVANDRTAFAALSDWTEKNLSGGDITKALPSWLWGQTKAGDRNAWGVIDTNNAADSDM
WIAWCYLDTAKGRAMLELLKREVREVENLGKVILPGRVGFEDKNGTVKLNPSYYPLFILR
RFALEDAYWTDVYDGSLRMLIRSAPSGFAPEWARFTNQGRLVPPDATDYTEGSYNAIRTY
MWAGMMSPEDPGRFSLVERFQPMVDATRKLNFPPEKVNVVTADVEAPGPAYFGACLLSLL
GNDRTAGLIRTVLAAEGVNKDRYYGNVLVLYGLGFDEGRFLFDRDGRLVIRMEEAQK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	24	335	2.7e-61	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	5.39e-131	24	355	25	371	cellulase.
COG3405	BcsZ	8.12e-73	24	342	26	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	8.63e-48	27	338	8	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	5.56e-254	1	357	1	367
QQS88762.1	5.58e-171	1	357	5	368
ANU67169.1	1.75e-105	1	350	1	350
QQQ96024.1	1.75e-105	1	350	1	350
AMJ68802.1	3.54e-92	12	349	10	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.05e-83	21	349	1	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	3.50e-83	21	349	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	4.20e-82	21	348	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.18e-81	21	348	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	1.35e-78	21	349	1	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	6.80e-88	15	349	17	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	1.09e-86	15	349	17	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8X5L9	3.36e-85	1	349	4	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	7.57e-84	12	349	15	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	2.04e-62	11	349	21	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000436	0.998790	0.000218	0.000174	0.000179	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000632_01397.