CAZyme Information: MGYG000000633_00703

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_00703
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000000633_6|CGC1	64975.92	6.0444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 33672; End: 35423 Strand: -

Full Sequence      

MSSIEKFDWRKIENGLRIPAITYSDQPYVVRTDDGAWLCCITTGSGAEGAAGQHVITTRS
TDCGKSWSEPVAVEPPDGIENSYAVMLKAPGGRIFIFYTRNSDNVRKILTHDRKQTFTRV
DCLGHFVFKYSDDHGRSWSAERYDIPFRLFRCDRDNVYGGKLCFFWNVGHPFAYGGSAFV
SLIKVGEMGDGFYQQSEGCLLKSPNLFTVSDPADAVWETLPDGDVGLRAPAGGGRVSEEQ
NFLALSDGSFYVTYRTVDGYSVEAYSRDGGHTWSAPRYMQHPDGRRVKHPRAANFAWRCG
NGNYLYWFHNHGGRFVGEEPRIAYEDRNPVWLLPGVEADSPEGKVIRWGEPEILLYSDNP
MVRMSYPDLVEEDGRYFFTETEKNLALLHEVPAAFLEKMWTVAAGKSVVPDVPVLFASGP
GPAELPAADLPELFKRNQQAHDFHGERTRAGFAITGEIAPGASGLLLGNRASDGRGLALE
YTSDRRLVLTLDDGAGESRMVSEPVPELRKFAVIVDGGPAIVSFVADGKFLDGGDDRQFG
WRRFNPELIRRPNRSPWRVGAGVLHLKFWNDRLQTADAVSLTR

Enzyme Prediction     

No EC number prediction in MGYG000000633_00703.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	15	276	1.8e-16	0.6549707602339181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.83e-12	17	276	15	240	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	6.29e-10	48	378	13	279	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.91e-04	19	139	194	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	0.001	30	147	151	246	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	0.005	9	120	150	254	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS36327.1	1.42e-146	8	580	22	568
QDU54552.1	2.73e-118	12	400	54	435
QHV94280.1	3.26e-118	8	580	29	580
QIP17358.1	7.17e-117	8	580	29	580
QGY47823.1	3.40e-107	2	580	18	591

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_00703.