CAZyme Information: MGYG000000633_00827

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_00827
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		94253.06	8.4197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 86531; End: 89050 Strand: -

Full Sequence      

MLRTLKQTALAALTALSVPLVAAEPPQFDVNQIKWEMTRYSKIVDRGGKKYILVQVPKGA
KDIANKNCAFFNIDLAPFAGYDLEFSVKARGRNISEPAQSFNGGKVMLYFQDRNGREYWP
GAAVPRGTFDWTTIKVLTMVPKGAHSGRFRLGLQESSGEIEFDLSSFKVGVPGIEEEEKL
PLTPDLARELDLIESRMRAELLKGKVATPEEVREVLAKQNPDGTFNDIDYNDDNRSAWRV
AKHLGNAHLLARVWATKGHEYYHDKKVGEAVQKAVDWWGRNRPISSNWWWNDMSVPQTLG
NIMLAAPELFPEGELRTRALIVCRQAKYLPRYTGNNLVFIAQNIFRRALLERNVAPLTKA
AGIIAQEIRMAPVHNKTEWAFGGIRADGCYHQHGPQVQFGNYGGEFFSNIAYWSNIWEGT
RWQLTPEQWQVMRHLSFDGFQWILWNGDMDLLACGRQLGENAAHTKGLRTITAFEKLRAA
DPGDKAPYDAVLKRNAEKVNTLVGNRHFWNSDMMVHRRPDWYATLRMNSVRVRPIEDDTN
WDNSLGRYFSDGVCLVTRTGKEYDNITAVWDWTRLPGTTLPATPIISTKNRRWTLSQKGT
SRQLGETAFVGGVTDGIRGAAVFTMDLDGVKAKKAYFFDTDAIYQLGAGITSTVPYGVET
TVNCCIRNGEIKQGKNWFHHDGIGYRGENIRLLTGERTGDWRILEGGRTEPKPETKDLFQ
LRIDHGVKPENATYSFAILPDATPEETANWNKGKVLSNTETCQAVEFNDGTIGAIFHAPG
KLDNFETKAPGAFLIKGKKVLAVDPSAKLQEITIVLDKVSKSVKLPDGEMEGTAVEVEF

Enzyme Prediction     

No EC number prediction in MGYG000000633_00827.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	506	741	5.7e-55	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	5.53e-112	186	805	6	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.28e-68	505	743	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	2.91e-24	208	494	28	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	3.85e-07	756	813	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45527.1	0.0	15	839	12	848
AQT67414.1	1.64e-104	216	782	63	631
QDO70957.1	5.51e-99	192	833	61	714
QUT90620.1	1.43e-98	176	833	44	712
ACB77597.1	2.94e-98	209	838	63	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	6.55e-79	191	837	7	677	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.04e-78	191	837	29	699	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
6F2P_A	1.52e-26	215	766	48	650	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2WCO_A	1.08e-23	287	831	139	737	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	1.31e-22	287	831	139	737	TheX-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	5.69e-78	191	837	29	699	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
P59807	6.77e-07	383	746	491	885	Chondroitin sulfate ABC endolyase OS=Proteus vulgaris OX=585 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998978	0.000163	0.000196	0.000163	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_00827.