CAZyme Information: MGYG000000633_01430

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_01430
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000000633_16|CGC1	66363.88	5.3088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 5436; End: 7214 Strand: +

Full Sequence      

MMQQQIVTGAGEILFSGELDGWNLSSRTSTEGGVTFLELRLDRPDPAMLPFFRLLWHASA
LDCQCRWTPLAGNNKLLPPNWGSRQSFQLAIGAPVMCFLNQAGVNRLTFACSDALNVVQL
GGGIEEKLGVLECSVECFRTPGAPASEHCCTLRIDSRPVRFEEALADVASWWAAMPEYAP
SPVPEPAREPMYSTWYSFHQDLFDHEVEEQCALAAKFDLKSVIVDDGWQTEDNHGGYAFC
GDWEICRKRFPDMAAHVRRIHALGLKYLLWYSMPWAGFESAAYRKFAGKLLYRDERLNAA
ALDPRFPEVREYLIGIYERALHEWDLDGFKLDFIDSFEFRPAGSEDPAIAENYAGRDYKS
LALAVDRLLTDTMNRLRAIKPEIMIEFRQRYTGPAMRKYGNMFRAADCPYDAVSNRIRTI
DVRLLAGNTAVHADMLMWHRDESVEVAALQFLNILFAVPQISVRLEVVPESHRAMLRFYL
GFWREYRDVLLDGTLRAEHPELNYPVVSARSGSRSVVAVYGAGSLVELDPAPGEEVNLVD
ATGCGRIVLSLARAPREAAAFTATGVPAEIPTPGAGCRLLTMPVSGVLRLRF

Enzyme Prediction     

No EC number prediction in MGYG000000633_01430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	181	495	1.5e-28	0.45494186046511625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	8.05e-65	187	485	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.64e-10	188	333	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	3.48e-10	194	332	51	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	4.44e-09	180	333	284	442	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	2.01e-07	190	288	2	100	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	5.23e-203	11	592	8	587
CQR57728.1	3.31e-193	16	591	14	588
AIQ58516.1	1.81e-185	6	553	4	549
QSF42796.1	4.50e-185	2	591	1	589
ASA19679.1	9.97e-185	8	591	10	592

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	1.23e-06	179	334	301	465	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_01430.