CAZyme Information: MGYG000000633_02013

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_02013
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		61574.45	6.6563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 34710; End: 36359 Strand: +

Full Sequence      

MLNTDRKLHYPGMEPDDKVRRYVPPRRIVRAIAAENSGVLLKLQLQSFCHFNPDPCILAP
GGEVILDFGIELHGQLALTFGDLHQQRLPLKVTFGESVSETLGTPTRDHAVHQFTLEPPN
LGQFFLGNTAFRFVRLELAPDAPGPLPLLAAAAVAIYRDWEYKGFFQSDDARLNRIWEVG
AYTVHLNCQDYIYDGVKRDRLVWMGDLYPEIRTLLSVFDEEELIRKSLDFVRDRTPDDKW
MNTASSYSCWWIICQHDLHLYRGNDAYLLQQKPALTGLLRRLLACVAPDGSEALTEWRFL
DWSTAENDAAKHAGLQGLLAWTFRCGATLCDKLALPELAAECRDAERRLRSIRPDCRGNK
IAGAMQVLGKVADPRQINEEILRKDPAKGISTFYGYFVLLARAAAGDVAGALDLLRNYWG
RMLDFGATTFWEDFDLDWTSGAYGIDSLPLPGRKDIHGDFGKHCYTGLRHSLCHGWAGGP
TAFLTEHVLGVRPLDPGFRTVRINPELPGLRKVEGAVPTPLGTIEVVAEQTSCGVRARVR
LPEGVRQLP

Enzyme Prediction     

No EC number prediction in MGYG000000633_02013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	60	545	2.8e-87	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-16	164	488	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.81e-09	490	546	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45729.1	1.75e-282	3	548	4	548
QTN30984.1	6.05e-161	55	548	83	582
AFC30266.1	1.49e-159	16	545	13	560
AEI41762.1	1.49e-159	16	545	13	560
QEC52590.1	2.15e-159	14	548	37	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.56e-42	60	537	190	685	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	7.02e-21	58	489	89	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	3.82e-08	131	542	438	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_02013.