CAZyme Information: MGYG000000633_02196

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_02196
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		55576.02	5.5336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 13462; End: 14922 Strand: -

Full Sequence      

MEEQSFLFRPTERPFPEADIPRVIYDRNPEFAAFYDEAWRLAWTRVYESEHLPRSPYMSE
GCRTNRIWIWDSCLMLHFCLYSPAFPSDNTLDNFYDVMAGNGGSGGILVHHPDNPPLFAW
TELRRYRMTGDLGRVRKLIAPDGALVRHYERVESFKAGERVPWGAVKVWAEKLPHGYLWG
GLPSGMDNTPRGGGVPYEEMLWFDLAAQQGLAALSIARLAEAAGDDSCRERFLREYQLQK
ALTRSFWDERDGAFYDRRNTPEREFCRVLTPASLWPFLAEMGTEEQLDRMAEKLLDPALL
GGLVPFPSVSRSDPGFDPHGGYWRGGVWLPLCYMGIKALEKYGRFDLARTLAERVLIHMK
RTFDEYEPHTIWECYSPTEYLPSTSKRGYCRPDFCGWSALGPISLLIEDLIGIYDISVPE
NTIRWRLSGPERHGVTNLSFGSGRVSLVAEEGRIEVESSRPLQLEVNGIPFACPAGRSEH
RLRAQE

Enzyme Prediction     

No EC number prediction in MGYG000000633_02196.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	3.02e-17	113	413	339	610	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	2.97e-16	172	400	209	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	1.14e-14	216	358	591	742	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.72e-13	216	366	318	466	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.17e-10	132	365	270	509	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZT38129.1	9.28e-139	21	482	33	502
AHF90735.1	2.65e-132	21	468	29	497
SDU91719.1	3.83e-130	10	476	2	476
QIU93173.1	1.09e-128	20	476	32	492
QDV72106.1	1.32e-126	19	479	35	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.10e-07	216	360	564	717	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.10e-07	216	360	564	717	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.10e-07	216	360	564	717	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.16e-07	216	360	113	266	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.16e-07	216	360	113	266	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.45e-36	20	467	6	451	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q8PPT1	5.63e-08	41	398	138	536	Periplasmic trehalase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=treA PE=3 SV=1
Q2NYS3	3.00e-07	41	398	138	536	Periplasmic trehalase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=treA PE=3 SV=1
P42592	6.07e-07	216	360	587	740	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
Q4UZ12	1.21e-06	56	398	162	536	Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999819	0.000213	0.000010	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_02196.