CAZyme Information: MGYG000000633_02287

Basic Information

• Species: Victivallis sp900768515
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900768515
• CAZyme ID: MGYG000000633_02287
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		73305.41	6.7327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000633	2845403	MAG	Madagascar	Africa

• Gene Location: Start: 11651; End: 13606 Strand: -

Full Sequence      

MSCHSLSLLMCALPLFLPIALSADDSSELAQRVRAELLENQPLSDAETGKILQLQRSDGS
WEDIDYDSQIRSNWCSGEHMRRTRNLARCWAKPGQKLYHDPKIGDSIRRAVADWCNHKRQ
SANWWWNEIFVPEAMADTLLLAPELFDRSAREAALGIVRQASFGMTGQNRVWVATIVFKR
ALLEGDRQTMAKAVAEVTAELRLSDQEGIRPDGSFHQHGRQIQFGNYGSGFLNSISRWAV
LLQGTSLEFTPEQWKLLDLLVLDGYQWVLWNGRMDYLASGRQIGKGTLEGKAKGVLSSIQ
RLASCDPSRRDEYLELMKRNQGGRNTLSGNRHFWNSDYMVHRRPDWYASVRMNSIETTPI
EDYINWDNALGRYLSDGALLVMVSGDEYRDITACWDWTRLPGTTLPATPILTEKECRERN
ITSSGVHPRWTLSRKFRRQGESRFTGGASDGRHGAAIYSMELDGVRAKKAWFFDDDAIYA
LGCDISSDSPYPVATTVESSLRNGEIKKGDNWVWHNNIGYVGEGLFVATGVREGDWRYID
GGSKDPRPVQKELFQLTIDHGLKVQNGKYAYTILPAATPEETAACKGARVLANNSRLQAV
EFADGTRGAVFHEPGQLGDFTADRAGIYLIGEKEYFYADPAAKTPAEHRDR

Enzyme Prediction     

No EC number prediction in MGYG000000633_02287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	331	576	8.7e-56	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.92e-130	25	640	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	8.31e-73	330	578	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	4.13e-35	58	319	43	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	1.24e-04	591	640	1	59	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45527.1	1.40e-242	19	643	179	817
AQT67414.1	4.02e-122	11	633	9	652
QIK53168.1	1.23e-108	27	600	57	636
QIK58581.1	2.61e-107	29	600	59	636
AHF15153.1	2.60e-104	11	633	17	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.36e-80	29	643	9	642	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.55e-80	19	643	21	664	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RW9_A	1.59e-28	82	622	78	681	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	1.59e-28	82	622	78	681	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
6F2P_A	6.37e-26	61	632	58	684	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	8.50e-80	19	643	21	664	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	3.98e-24	46	601	55	675	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999200	0.000147	0.000149	0.000133	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000633_02287.