CAZyme Information: MGYG000000634_01518

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; SFHR01
• CAZyme ID: MGYG000000634_01518
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000000634_59|CGC1	38172.55	9.941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000634	1737692	MAG	Madagascar	Africa

• Gene Location: Start: 2210; End: 3217 Strand: -

Full Sequence      

MKKTFFCFFCCWQALVFAGEQQYEPLSASVQAALHDAVSDSRPMISSFKSPLKAANWLAD
MSARLSRRIPERDYRLDLLRSVHYEATRAGLDPQMVLGLIEVESAFRKYAVSSAGARGYM
QVMPFWLKVLSRPNDNLFDMRTNLRYGCTILRHYIDIEKGDLFRALGRYNGSLGRAEYPN
LVKNAWNKWLYTSETLIAEPDTAPTPITTEPSPLPTAPITQTTPQVAENVYVYPTTIINQ
IEEQRVIVVPNHHHRHRPPPPQLPPAPQTLKERNAQRVQEIQQKARNASGLNPSNNPRFL
NQNQQTPNRAAPPPPQHRRTLPPPPPQHRGYYAPF

Enzyme Prediction     

No EC number prediction in MGYG000000634_01518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	88	178	1.8e-17	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.07e-24	93	178	1	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.81e-21	82	200	8	129	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.69e-19	82	190	10	115	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.32e-18	86	175	5	98	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	5.65e-17	14	180	70	248	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXS79059.1	3.25e-98	17	193	17	194
QRM18835.1	1.36e-97	17	199	17	200
QRJ65136.1	5.53e-94	18	191	21	195
QDX82242.1	1.47e-92	18	188	22	192
CAB1367468.1	3.05e-92	11	188	16	193

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.77e-07	73	177	57	157	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P27380	2.75e-06	90	184	19	110	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005636	0.990016	0.003566	0.000229	0.000253	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000634_01518.