CAZyme Information: MGYG000000636_01762

Basic Information

• Species: Gemmiger sp004555405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp004555405
• CAZyme ID: MGYG000000636_01762
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000000636_25|CGC1	69756.9	6.6801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000636	2454584	MAG	Madagascar	Africa

• Gene Location: Start: 28766; End: 30643 Strand: +

Full Sequence      

MAKPKENLPADVARQDSLGGMAKRLLNPSHLADLASRSARTLREQGAEQLWRELDFRVNL
ALHRDKWQHRADIPTKRQLRMQRQNSIQGPVFSVVVPLYNTPIPFLRQMIASVQAQTCPK
WQLVLVNASDAQHPEVGKAAAAYAAKDHRILLVDHVENGGIAKNTNVGFAASTGDWITLL
DHDDVLYPNALYEAADAIAKTGAELVYSDEIVLSGNLKELGGYHFKPDFAPDNLRGCNYI
THLCLFSRSLAQRAGFEERSEFDGAQDHDLILRLTENTKKIHHIPKVLYVWRGHAGSTAA
GISNETKPYAIAAGERAVNAQLKRLGLPGRCEAIAGIPGAFRVVYELTAHPMISILIPSK
DHIDDLDRCLTSLDKLAGYDNYEVIVIENNSTDAATFAYYEQLPEKFPRCKVVYYQGTFN
FSAVNNFGEGFAQGEQLLLLNNDIEITTPGFLREMLSYSQRADVACVGAKLFYPDGTIQH
GGVIMGINGSAGHSHKGHPHDAVGDLYRLVTTQDFMAVTGACLMVKKSLYEECGGLDEEK
FAVAYNDIDLCLKLWKKGYLNVYTPFAQATHYESKSRGLDTTGENARRYEREKANFYAAY
SEYIDHCEPYYNPHFNNKFENFGLR

Enzyme Prediction     

No EC number prediction in MGYG000000636_01762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	93	208	9.9e-23	0.6647058823529411
GT2	350	575	3.2e-16	0.9304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.84e-80	90	292	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.78e-37	355	573	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.38e-27	351	603	3	250	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.05e-19	93	250	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	5.66e-19	93	298	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	3.17e-171	70	625	70	629
CAB1243278.1	1.84e-163	23	625	433	1033
QMW89744.1	2.82e-163	13	625	6	615
BBK78193.1	2.82e-163	13	625	6	615
QUC66692.1	2.41e-160	74	625	399	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.20e-06	89	205	4	116	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	6.11e-120	89	613	365	886	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.35e-85	90	625	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4UM29	1.53e-10	86	307	10	233	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	6.14e-10	80	393	4	334	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q9ZDI9	9.89e-10	84	309	2	227	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000636_01762.