CAZyme Information: MGYG000000637_00086

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000637_00086
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000000637_5|CGC1	39376.48	10.1855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000637	1277650	MAG	Madagascar	Africa

• Gene Location: Start: 11938; End: 12939 Strand: +

Full Sequence      

MIPKKIHYIWFGSKAPSAKESFCIESWKKILPDYQIIRWDDTCLDKFDNLYFKQALEQKQ
YAFASDYARLKILYEEGGIYMDTDEEVLRPLDKFLIHDFFMGCQSCGSARGLSPALVGAV
PHNQIIKDLLDVYNSTPFINPDGSLNRTTNPVYFADVLTKKYNIPTTYLKKGQIEFYPNS
FLYDYFHFAKQDKTSYAVHHYAGNWKPDWNIKDKFEITIFGTHYIIRKYKKNRETLWQNP
AKDEKLVLKIQTSKKSFWTLIKKRCSEKTWNFDLKEFIYLIETQLKAARILWGGVKRKNT
KTKHLKSRNKTTSNKRHSAIKRHLKTSNKARLR

Enzyme Prediction     

No EC number prediction in MGYG000000637_00086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	95	2.8e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	7.80e-17	1	97	81	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.43e-15	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam12919	TcdA_TcdB	1.63e-04	49	84	158	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam05704	Caps_synth	3.45e-04	23	101	68	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ13839.1	9.68e-57	2	263	4	264
QIM65043.1	6.69e-54	2	264	4	267
ARA24251.1	1.67e-53	1	263	1	263
QUC06113.1	9.87e-53	2	262	3	262
AJA44712.1	1.39e-52	2	264	4	265

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZU30	2.41e-06	2	131	28	185	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000637_00086.