CAZyme Information: MGYG000000637_00148

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000637_00148
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43448.85	9.4286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000637	1277650	MAG	Madagascar	Africa

• Gene Location: Start: 10822; End: 11988 Strand: -

Full Sequence      

MNTSNKLKIYLIAGEPSGDLLGSRLMRALKEKTGGQVSFFGLGGDTMEREGLKSLFDISD
LAVMGLAEVIPSIPLVLKRIDQTIEDIKARQPDIVITIDSWSFCSRIHKKLRRLNLGIPQ
LHYVAPQVWAWKKHRAKTMYRYVDELLTLLPQEPPYFTKYHLKTIFVGHPVIESEALTAD
GAAFRRKFNISEDKQIISILPGSRKTEVAKLLPDFLKAAELLQESNPDIFFALPTVKTVA
KRVKEYVKKSKLPMVVLETEADRYNAFQASSAAIAASGTVALELAICNIPHIIAYKVSPL
TYFLAKHLVKIKYVNLTNILLNKPVVPELLQENCTPEKIVREIHELLKNGQAYEKQMEGF
AEVKAHLSCGNQTPSQNAADAVLDLIKC

Enzyme Prediction     

No EC number prediction in MGYG000000637_00148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	367	1e-127	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.23e-154	7	387	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.39e-145	7	388	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.69e-111	9	359	1	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.51e-89	9	385	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.69e-49	8	370	3	335	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	3.19e-166	4	387	2	385
ACI98608.1	5.16e-124	7	386	4	383
ASG20768.1	2.39e-121	9	386	8	385
ARJ65449.1	6.36e-121	7	387	6	387
CUW40282.1	9.01e-121	3	387	2	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.20e-67	1	385	1	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.10e-67	1	385	1	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6IST7	1.03e-124	7	386	4	383	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q2W4D7	8.72e-121	9	387	3	382	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
Q5FUA3	1.88e-93	9	386	31	405	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	1.75e-85	9	386	6	391	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q89KQ7	2.36e-79	6	383	8	384	Lipid-A-disaccharide synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000637_00148.