CAZyme Information: MGYG000000637_00888

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000637_00888
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		28493.15	10.3759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000637	1277650	MAG	Madagascar	Africa

• Gene Location: Start: 1269; End: 2009 Strand: -

Full Sequence      

MRLFVSKFLMFLLFLLMFIQPVEASEYPKFVEDTDVCTVAAQQYEKKYQIKKHLLSTITN
VESGRWNKEHQRNMAWPWTVNALGKGRFFETKQQAIAEVKRLQSQGVKSIDVGCMQINLA
YHPEAFDNLEEAFNPYKNMEYGAKFLKKLYAQKGNDWNKAATAYHSSVPKKAQKYAMKLS
KVYKGIMQAHLETKAVNKTVAKAKRLEKEKLLAKNRTEIEAKIAQSANAWREARLAEYRL
RKAGQL

Enzyme Prediction     

No EC number prediction in MGYG000000637_00888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	193	6.9e-17	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	1.02e-13	48	184	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	3.69e-09	80	152	31	102	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.18e-08	108	181	32	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.16e-06	112	165	25	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.45e-04	114	177	186	250	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10590.1	3.22e-53	17	179	1	163
CDK98691.1	8.44e-47	37	243	23	242
AVM77174.1	1.19e-46	37	243	23	242
AVM73271.1	1.19e-46	37	243	23	242
AMW35440.1	1.09e-45	34	183	42	190

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000183	0.999240	0.000150	0.000145	0.000130	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000637_00888.