CAZyme Information: MGYG000000637_00950

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000637_00950
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000637_134|CGC1	39493.97	8.7407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000637	1277650	MAG	Madagascar	Africa

• Gene Location: Start: 975; End: 2066 Strand: +

Full Sequence      

MMKDKKLVILTAGGTGGHIYPAEALATELEHRGFNVMLFTDARGLNNYKGKLGEIENRAI
CSGSVIGKSVLTKIISLFKVGLGVLQAGFYLFRVKPCCVVGFGGYASFPTAVAAIILRIP
LIVHEQNSVMSRTNRILAPFASVVAQSFRKVKNTPKGSKSVLTGMPVRETIALLHEQPRK
KSSDKKTLVILGGSQGARVFAEVVPAAVKLLDGKLQEKLTLYQQCRKGEEAQVEQAYEGI
PCKTIVRSFFENMPELYSQADFMISRSGASSVYEIAAAGVPAMFVPLPIAADNHQYYNAE
EFVEAGAACLVLQKDFTPEKVKHVLEDLFSNSEHFAVMSEKAKDMALVDASAQLADVVQH
FVC

Enzyme Prediction     

No EC number prediction in MGYG000000637_00950.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	187	349	1.8e-47	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.82e-136	5	359	1	352	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.67e-124	8	357	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	6.93e-113	6	358	1	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	4.16e-105	6	358	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	3.37e-46	187	354	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10292.1	1.92e-127	3	359	5	363
ARJ66991.1	1.80e-80	1	358	1	361
AVM80177.1	2.47e-80	4	358	2	359
AVM76274.1	2.47e-80	4	358	2	359
CUW38580.1	5.09e-80	1	358	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.17e-57	6	359	10	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	7.24e-51	8	356	5	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	3.68e-45	3	360	5	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W0H3	8.09e-80	1	358	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=murG PE=3 SV=1
Q2RVU4	7.26e-79	8	358	19	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=murG PE=3 SV=1
Q11GS5	8.92e-74	6	359	4	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Chelativorans sp. (strain BNC1) OX=266779 GN=murG PE=3 SV=1
Q8CY39	3.13e-72	2	362	4	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=murG PE=3 SV=1
Q2YLY5	4.41e-72	2	359	4	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Brucella abortus (strain 2308) OX=359391 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000637_00950.