CAZyme Information: MGYG000000640_00335

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_00335
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630		70069.28	9.075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 112162; End: 114054 Strand: -

Full Sequence      

MEKEKTTVTTEKAPAKKTVAKTAPKKAATKEPAATKTTAKKSAGAVKTVKAPASAEPKPT
VKKPRKTSAKATVPAVKEQATALAVKEKAKTPTTRAKAEKPTIKEKATAPAVKEKAKAPA
PRAKAKTPAAPLKPFPTDNATEVKAEEIAKTAPKKPRVLMCAAEAWPFAGTGGLGEVIGS
LPKALNAEGEAEASVILPLYESVPAEYREKMEFITHITVPLAWRNQYCGLFKLVRDGVTF
YFVDNEYYFKRGGLYGYGDDGERFAFLSRAILELLPYLDAKPDVLHCHDWHTALVPIYYK
LYYQYRENLGGIRTVFTIHNIEYQGQFSGSVLEDLFGISYREYMSVEYHGCINLMKGAID
YSDAVTTVSPTYADEIKRPEYAHGLENVLLKNAYKLRGILNGIDTDVYNPATNPALFKNY
DDKTVDEYKKENKLGLQRMLSLPEDENVPMIAMISRLVSHKGFDIVRSAFGDILRDNVQF
VVLGTGDAEHENFFRHMQSVYGDRVRSVIAFNKDMAQKIYAAADIFLMPSKSEPCGLSQM
MALRYGTVPVVRACGGLRDSVFDCGNGDAGNGFTFDNYDRDSLIHAVDRAVGLCRDYRDK
WISLRHRAMECDYSWDSSARKYADFYKELI

Enzyme Prediction     

No EC number prediction in MGYG000000640_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	157	627	1e-176	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	157	629	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	157	628	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	157	630	2	464	glycogen synthase GlgA.
COG0297	GlgA	4.06e-177	157	630	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	2.11e-104	157	630	5	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49200.1	9.22e-175	157	630	2	472
QNO18264.1	5.07e-174	157	630	2	472
QNK41915.1	5.25e-174	157	630	2	472
ARP51332.1	2.89e-173	157	630	2	472
QKN23272.1	2.89e-173	157	630	2	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	2.77e-92	158	630	12	498	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	5.53e-83	158	627	127	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
2QZS_A	5.79e-82	157	629	2	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	4.39e-81	157	629	2	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	9.73e-81	157	629	2	476	ChainA, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	1.04e-154	157	630	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A6TSC8	1.41e-153	157	629	2	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
A0PY73	2.67e-149	158	630	3	476	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
Q8XPA1	2.36e-148	157	630	8	481	Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgA PE=3 SV=1
B2TR28	3.30e-147	157	629	2	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_00335.