CAZyme Information: MGYG000000640_00405

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_00405
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		82142.42	5.221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 58936; End: 61110 Strand: +

Full Sequence      

MNDFIGNFIKAKREFSHGFSRHDPSPLFRRAFTLKKTGKATLYACGLGYGRYYINGVEAE
GDLFTAPAASYDKLIWYNAFDVSNLLHDGENVIAVALGNGFFNESFDSHWGNNKAEWRDN
PKFALSLVADGEIVLTSDETFRCTTDSFITFNQLRSGERFDARLYDPRWTRADFDDSGWN
FAVADHSLDNVEKALCTCPPIVESEVLDFVEAIATDDGYTLDFGKNISGYVRFHDRHAVS
GDEITFTHAEEIYADGRLRLNNLDILYPSVDFQTDRFVSCGKPIVWSPLFTYHGFRYVHV
TGLRRKPEKGEIRAVFVCQDVSATSDFRCSDPLLDKIFAAGILSTRSNMFYALTDCPTRE
KFGWTNDAQASAEQTLIDFDIKGLYEKWMRDYCAVMKDDGSVPAIVPSHGYGYAQGPVAD
GALFEIPYMVYLYTGDPSLLVRTLPYMKRYYEFFVTESDEYWLGDWDGYKNNVDDKNFIR
EFYTVKFCRILKFACGLAGENPARYERDLSETEDKIRSVRLTPSGGSVVRNQTVVSMLLS
LKVGNADVLVGQLKKLIDEKGGHLDCGMLGTQYLYDALSENGAEDYAYKVITARGIPGFR
AWFERGAMTLWETWRDNFTDSKNHHMFSNVLAWFFKALLGIRVREDGAGYKKIDFTPRFV
SALDYCRGYVTSPQGRIFAEWKRTDGAIEYTITLPAGVEGNYDGVKLKEGRNTFTVKEAK
NEAI

Enzyme Prediction     

No EC number prediction in MGYG000000640_00405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	216	701	4.7e-115	0.9821428571428571
CBM67	21	183	1.7e-26	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.42e-63	324	638	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.13e-36	35	201	1	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.35e-18	213	317	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.02e-10	643	699	2	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF16194.1	3.71e-117	25	700	172	857
QGQ94103.1	1.86e-116	24	711	142	853
QUT54420.1	2.36e-113	17	696	132	834
QRO16731.1	3.30e-113	17	715	132	857
QKH99925.1	3.30e-113	17	696	132	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.76e-94	25	721	176	912	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.42e-55	35	695	314	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.66e-52	28	681	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.32e-74	28	701	187	903	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.35e-59	22	722	172	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.20e-55	35	702	181	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	7.39e-55	35	695	314	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_00405.