CAZyme Information: MGYG000000640_00406

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_00406
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		60800.45	4.7079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 61097; End: 62746 Strand: +

Full Sequence      

MKRSDDTTRELIYPERVVASENAERERLLLRRDPPFIRLPEKTDGLTKIGSGGFVLLDFG
RELHGGVRLLFGETYRDNATVRIRFGESASEACAEIGEKNAGNYHSPRDFVYPAITHSDT
ECGQSGFRFVRIDVPDGEYVYVKQILAVSVAENHEELGSFSCSDDTINAVYRTAIDTVRL
CMQNGTLWDGIKRDRTTWIGDLHPEMLASFQAFGNTGNVLSALRAAESYVDEGGWINCIP
SYSAWWLTCLADYYEYVGDRDILTDELERIRAVALSINNIVTEEGDIDYSGSKLNIFEDN
EYFFDWPTNFTPDSKDGMKAVLAVGLGKIARALDESGTDVALAEKCAKIAERIAFSWYDG
QFKQVVAMRYFAGKEDENSVRKTIGANGAAGLTGFTGYYILAAGAECGLDMLGVTKDYYG
AMLGLGATSFWEDFDVGWLEEKPCPIDRLPDIGEKDVHGDFGKFCYKGFRHSLCHGWTAG
VAAFLSRYVLGVRPAAAGFKKVRIEPHLGSLTFAEGTVPTPHGVIRVRVDRVGEKTMVKA
ELPEGVEAE

Enzyme Prediction     

No EC number prediction in MGYG000000640_00406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	51	549	1.1e-78	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17390	Bac_rhamnosid_C	3.33e-11	491	549	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	1.28e-10	155	489	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV41231.1	7.71e-111	3	546	6	553
BCG54529.1	3.82e-108	3	546	33	579
QUT95156.1	4.64e-106	2	531	20	562
AST53793.1	4.64e-106	2	531	20	562
QJE27358.1	1.26e-105	55	531	78	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.63e-28	38	545	178	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	7.88e-22	126	549	504	948	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.29e-13	48	490	88	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	3.46e-07	31	549	344	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000095	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_00406.