CAZyme Information: MGYG000000640_00483

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_00483
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000640_4|CGC1	90618.92	7.149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 32334; End: 34778 Strand: -

Full Sequence      

MDDILKLLRELSTEEKAALVAGTDFMFTNPVLRLNIPKIRMSDGPHGLRVQQQGGDNGVA
GSEPATAFPTAALTACGWHEDNLYKMGEAIGEEARHYGINIVLGPGVNIKRNSLAGRNFE
YFSEDPLLAGKMGAAEINGIQSRGVGVSLKHFALNNAENYRFMGDSVCDERAMREIYLKA
FEIAVKKAKPETVMCAYNKINGTYCCQNKWLLTDVLRKEWGFDGLVMTDWGATHDRIEML
KAGLDLEMPGDTDICRKWIIDGIKSGELSEETLDKAVENVLKLVYKHAGRKTERADFAAH
DLLAEEIAEDCAVLMKNDGTLPLSVDKRYFVAGELFEKMRYQGSGSSMINPWRLTTPKNA
FDKAGVKYEYHKGYKENQTAADKALIDEAVKRAEKYDTALAFIGLTDYVESEGCDRENMR
LPENQLALIDALIKTGKKVVVVLYGGSPVELPFADKTAAILNMYLPGQRGGEATRKLLFG
EKNPCGKLAETWVKSYSDVPYGDKFSKTQIEVYKESVFVGYRYYQKAKKTVAFPFGFGLS
YTTFGYSDMKIEENGGEIIVTATVTNTGKRFGAEVVELYVKAPITDVYKPEKELRGFAKV
YLAAGESKEVSITVNKSDLGYYNVKEKRFVTESGDYEIQLCSDCESIKLSETVKIDGENV
PSPYDKEIFDLYEHAPDKISDEAFEKTSGRKIPALPPIKPITFESRFTDLKATFMGKILY
NAVLSVAKKDMKKAKKLPEGAERDNKIKGAMFLKRILESNSIITMSMSAGKSCPYHFAKG
FVDMANGRIIKGIKDFCSPVKTAALPKNEDKEKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	249	2.4e-70	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.54e-98	33	651	101	761	beta-glucosidase BglX.
COG1472	BglX	9.03e-75	10	333	16	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.19e-58	7	615	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.60e-55	312	541	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.36e-45	33	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25260.1	6.11e-296	3	809	25	732
AHF24834.1	2.19e-291	7	810	6	711
AHF25921.1	8.07e-268	3	809	2	708
QYH55292.1	3.57e-234	7	810	12	825
QNO38010.1	8.45e-234	8	796	13	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.55e-193	3	657	4	670	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.95e-157	8	666	9	674	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.13e-136	1	658	1	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.09e-134	1	658	1	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.45e-103	3	658	5	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.94e-192	3	657	4	670	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	4.12e-157	8	663	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	8.18e-157	8	663	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q2U8Y5	1.12e-120	3	656	5	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	6.35e-119	3	656	5	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_00483.