CAZyme Information: MGYG000000640_00810

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_00810
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		62486.83	6.5681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 3708; End: 5354 Strand: -

Full Sequence      

MPSFPRTRSVAVVPEDAWRSLLVTRDGYIRYYGRYFDGRKEEYPECYIESRDCGVSWRTH
FPKNKAAIGASAYVPFLDKYCAMRSAEGKGTFFYAADSPDDTPTCVKVCDEEYIDFRLPF
TLKSRNRIIVVTHERRPDEHPTCFYAVLFISDDGGKTFRKITPEIAPYYPRASENEGVRW
QQNNRENSIEELTDGTLMMMSRTATDYHYVTYSKDGGDTWDKIRPSVFHSTGTMPFLKKL
SDGRLLFFWCNTNLLPELPEADGIWEDVFTNRDASHCAVSEDDGKTWIGLREFRLNNFRN
CPDFRARGGVSLYGGADKSVHQFEVIELPYDKVLVVSGQNKILRRATIFDIKWLYEKSRE
EDFLLGLSNISSQVYIKSVLGGYRLCCAGHCAYNRLPSAVMMPNPNVKWREAMYLTYLDD
DRLVSGVAGAVWNFPAAKKGKVVVRAKINGQPLRVTLLDHWLNPCDQTLANNQSAIVMEK
VDADDFFDYVFSFDTENRVVSVVLPNGKTESRPLPILPTGISYLHLQIAATDNAEVGVYV
SHLSFKAE

Enzyme Prediction     

No EC number prediction in MGYG000000640_00810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	122	289	4.6e-16	0.40350877192982454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	8.10e-17	127	287	157	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.79e-09	146	287	138	251	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	6.34e-05	106	287	4	186	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam15902	Sortilin-Vps10	0.004	148	293	3	115	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF26887.1	3.09e-120	8	546	27	580
AKA52559.1	1.66e-101	10	548	37	564
QCQ42527.1	1.66e-101	10	548	37	564
QNN21869.1	1.96e-101	10	544	39	606
CAH08632.1	3.29e-101	10	548	37	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBU_A	3.78e-06	173	293	268	390	ChainA, Exo-alpha-sialidase [Cutibacterium acnes],7LBV_A Chain A, Exo-alpha-sialidase [Cutibacterium acnes]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_00810.