CAZyme Information: MGYG000000643_00559

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Senegalimassilia
• CAZyme ID: MGYG000000643_00559
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000000643_5|CGC1	69663.61	4.1011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000643	2151853	MAG	Madagascar	Africa

• Gene Location: Start: 104623; End: 106494 Strand: -

Full Sequence      

MFNRVTLPLICALAVALSLVVPVCSFADVADDACAERESDGFANEYDQGSGSYANSWRYG
NSDAYGEGTGFALFANRLNSWWSESGVWYGSNGTIVNSAVGFGVDVSEHQGYIDWSQVQS
SGVTYAILRCGYGSDYSNQDDKRFLRNVQECQRYGIPFGVYLYSYATDNAMAQSEAEHTL
RLLREAGLSPYSLSYPVYYDMEDENQQGKLGSAALGSIASTYCNAIAAAGYTPGVYANTN
WWTNRLTDSAFSSWPRWVAQYNCECTYFGKYGMWQADSNTSIKGIDGRVDINFDFAGPIR
HKDTWVFSNGSWWYQYKNGSYPSNGWAYIDNAWYYFDSAGWMQTGWVLSNGSWYYLNSSG
AMLNGWQWVNGSWYYLDPANGAMVTGWLKDGQSWYWLTPSGAMAVGWADAWGTWYYMGGS
GAMLSGWQFVGGAWYYLDPENGAMATGWLKEGQSWYWLNESGAMGIGWLFVNGSWYWSDN
SGCLRTGWNQIGANYYYLDPTSCAMHIGWIDDEGTWYYCDGSGAMGTGWQFVNGSWYCFS
DAGKMLVGEQTIEGVAYRFASSGAMVTGWFNDGVAWRFYCGSGAMKSSSWEGDYYLLEDG
TMAKDQWIGSYYVGSDGRWIPGY

Enzyme Prediction     

No EC number prediction in MGYG000000643_00559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	104	285	8.9e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.40e-78	102	293	2	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	7.84e-77	322	525	441	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.22e-73	343	554	442	650	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.35e-65	343	525	485	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.24e-64	296	484	479	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB07228.1	4.69e-80	31	297	48	322
BAN76667.1	7.07e-70	12	330	13	323
AWY97591.1	6.76e-68	55	293	48	283
SOB72005.1	1.15e-63	1	293	5	267
BAK44097.1	1.62e-62	27	298	544	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	3.53e-23	104	292	272	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	8.45e-23	104	292	272	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	1.52e-09	103	292	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	1.98e-08	103	292	84	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999109	0.000215	0.000161	0.000140	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000643_00559.