CAZyme Information: MGYG000000644_00680

Basic Information

• Species: Prevotella sp900546535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546535
• CAZyme ID: MGYG000000644_00680
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000644_11|CGC1	36021.66	9.5263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000644	3556677	MAG	Madagascar	Africa

• Gene Location: Start: 4774; End: 5688 Strand: -

Full Sequence      

MVNKPTSNNNKRGGAKKTSSSPVRTTAKRPARRRRSRRSSGLWSRYPRWAWWIGGIAVVV
LYVFLFYHFFVGPTGFRWRALYGDEVYPEGYEIHGIDISHYQGDIDWEQLKNAMIKGCPV
RFVIIKSTEGSSRLDENFRSNFNQARDFGFIRGVYHFWSNKSTAREQAYYFLQQVHLTDG
DLPPVLDIEHKPDDKSVEDFQRDVLTWLHIVEDRYHVKPIIYTYYKFKEQYLSAPVFDDY
PYWIAHYYVDKVQYKGKWKFWQHTDAGKLPGIKGYVDFDIYNGSYYDLKQLCIGSNNNEK
IFNE

Enzyme Prediction     

No EC number prediction in MGYG000000644_00680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	96	272	2.9e-52	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	4.02e-68	94	283	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	4.33e-60	91	283	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.68e-51	94	281	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	9.76e-47	96	272	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	4.79e-43	91	284	61	256	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67813.1	3.62e-193	37	304	16	283
ALO48669.1	2.07e-163	45	295	32	282
BCS86629.1	2.91e-157	37	297	29	289
VEH15533.1	2.75e-152	45	294	34	283
QUB48086.1	7.39e-152	48	304	42	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	5.53e-28	91	284	14	209	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	2.15e-24	93	292	5	213	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5A6S_A	2.28e-16	88	285	16	205	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
2X8R_A	9.72e-14	93	294	4	210	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
6ZMV_A	1.57e-12	93	295	2	207	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	1.47e-46	88	294	62	267	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	8.12e-46	88	294	62	267	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	2.27e-45	88	294	62	267	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	5.41e-23	93	292	82	290	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P00721	9.16e-12	93	294	2	211	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999989	0.000028	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
49	71