CAZyme Information: MGYG000000644_00912

Basic Information

• Species: Prevotella sp900546535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546535
• CAZyme ID: MGYG000000644_00912
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1388	MGYG000000644_16|CGC1	158871.16	8.1951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000644	3556677	MAG	Madagascar	Africa

• Gene Location: Start: 11586; End: 15752 Strand: +

Full Sequence      

MKSLFRKVVAVAGLMPLCMVASAGNMGTGEVHAVFNGLEWQKGKGKLLVQFVKPDVVRVR
FQPEGKFAGNGTDVCVPRKDRKIKLRYGKDYLSMTSDSLVVTINQSSGAISYFDHQHHLL
LSENLKNPRSSQKVYQEKVTFNEKTRRVVHTANGDVEEMDVLKRDTLDSAYRYQMNFNWK
KDEAIYGLGSHIEDYMNLRGKKMWLCQHNLKAMVPVLNSTAGYGLLFDAGCAMIYNNVEN
SSYVEMEAAQEIDYYMMKGHNMDAVVANYRQLTGECPMMPQYLFGYTQSKERYCSSKELE
CIVREYRQRRIPLDMIVQDWSYWSAGHWGEMKMDPKFYPDKKALADSLHAMNCKLMISIW
PNAQFCPQHDDFKKRGWILPGGSVYDAYKPQARSLYWDYANNEFFKNGFDAWWCDSSEPV
DGDWNNPMRKGYGYQNHAERWKLNTRALSDMLGAERSQTYSLYHAMGIYEHQRAVTDEKR
VVNLTRSSYAGQQRFSTITWNGDTYASWKSFAQMIPAGLNFMATGCPYWTIDVGAFFVGP
DKWNRWFYKGEFPKGCNDPAYRELYTRMFQFATFLPMLRSHGTDTPREVWRFGNPGEPFY
ESIVNHIRLRYELLPYTYSLASKVTREGYTMTRALAFDFASDSIVHDIKDEFMMGPSFLV
APMTKPLMQYGEASRKMYLPKTDAGWYDYWTSKHEDGGRWIEAAAPIEHSPLYVKAGSII
PFTVCQQFTGEQPDAPYTIKIYPGADADFEIYEDAGDGYAYEQNAFATYRLHWNDKAKTL
EISARKGSYRNMVKERQFNIELLDGSKNTIIYKGKALKVVMGSDGMRNLLSPMPVIAEAK
PVGSVKMGNIDDFKEVQIDLPITEGPFKPTWESIEANYPGEPAWLRDAKFGIWVHFGPQA
AGESGDWYARNLYKEDHQAYKNHLKRYGHPSEMGYKDVLHTWNPTKLDPDALTRLYQKSG
ARFLMIQGVHHDNYDLWKSKYQPWNSVNIGPKRDLLREWVNACHKYHMRYGVTFHHEYTW
WWWQTAFGSDKQGGKAGVPYDGHLTLADGKGKWWEGYDPRLLYGIDLREYESVATAAQSG
WSPPKAGVFSRHLEYANWYAKQWALRMMDVTENYDPDFIYTDGTYEGPFTGRGTGTGYKC
NAMQTVMADYYNRQLKTKGKVDGFAIVKFRHPTNGTVNTAEFDFPDSINASQPWIREAPV
GDWFYAPNFTYDSGSMIRFIIEAIARDGNVALNIPLRPDGSIEDGCVEMLEKVGKWMKIN
GEAVYGSKAWKTLGEGEIVNGKLKTLPGGGLGSKQANFRFEAQDIRFTHGKNRKLYAFLM
NVPSAGQTVVVHSLADGKGYLASKIRSVKLLGYKGNIQWKQTSDGLQVTYPEHANLATAA
VLCIDIND

Enzyme Prediction     

No EC number prediction in MGYG000000644_00912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	254	720	5.3e-117	0.9976580796252927
GH29	858	1266	3.9e-78	0.9450867052023122

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06591	GH31_xylosidase_XylS	7.81e-144	274	610	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	1.40e-136	255	720	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	5.43e-118	141	819	115	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.62e-74	861	1334	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	5.68e-70	862	1262	1	333	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73061.1	0.0	30	821	15	823
QNL40586.1	0.0	36	819	40	840
QDM12716.1	0.0	30	821	15	823
QUT78610.1	0.0	30	821	39	847
QUT40383.1	0.0	30	821	34	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JOU_A	8.43e-135	247	807	370	931	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	2.16e-126	247	820	401	976	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	4.54e-110	237	819	388	984	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6DRU_A	2.32e-60	174	713	138	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
6JR6_A	1.25e-59	46	829	52	794	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	4.51e-134	247	807	369	930	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	2.39e-130	49	787	10	689	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q01336	4.90e-65	36	587	9	528	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
A2QTU5	1.69e-59	174	713	156	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
Q9F234	5.92e-52	45	766	45	721	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998914	0.000250	0.000185	0.000160	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000644_00912.