CAZyme Information: MGYG000000644_01978

Basic Information

• Species: Prevotella sp900546535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546535
• CAZyme ID: MGYG000000644_01978
• CAZy Family: CBM32
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1166	MGYG000000644_54|CGC1	131722.74	6.9923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000644	3556677	MAG	Madagascar	Africa

• Gene Location: Start: 14816; End: 18316 Strand: +

Full Sequence      

MKKAVVLMALLSQSLSMMYADNQAGTRGIGQYPGRPSQFTAPRMVKDNTYRNIALNRMVY
TSSNADFNLTGHLVTDGIITSKAPSFLSVKTNEGELSNRDKEKMIDGNTVTSQYIKGENA
FVEFNWEAMKVNLKKLEFTGELAFYKDKASQGYTIRVMGSHNGKKWEVLGEEKGSDLPGV
ATKQQVSSDPNKFQDVVKLPLRKLNVSIPLKKPGNYEHVRIELIMPGAAWWRIKLIDNTT
SWRPSMHFSSVWKSGLANKTDAKAQWLYVDLGTEADFDQVNLFWVNKAHQGKIQVSNDAR
NWSDIATLGQQKKKGLIEKVACKGHGRYVRLQLTEPDASGHYALSEMQVMGKGGLRAETA
NTLASKNGKQMLNQWQLRREGSDAWIQATVPGTVLTSYMNIGAVPDNRFDDNMRQISESF
FNSDFWYRTTIEHKPSANKQQHTYLNFDGINWKADILLNGEKIGRIDGAFIRSRIDVTKK
LKPGSNKLEVHVIKNAHFGVVKQKNLQNTDLNGGELGADNPTFHASIGWDWITNTPGREI
GIWNDVYLTNDNGVSVSDPVVTSTLNLPDTLASMTPSVFLQNADAVAKTVKLAGYIGKIK
FEQEVSLQPNEKREVSFAPTDYPQLKNQRMNLWWPNGYGSPYLYDAGFKVSDKASGEMIS
EVTYKAGIRQMSYADLETQTKIYINGKRLNPLGGNWGFSETNLNYRGREYEAAVRYHKEM
NYNMIRDWVGQIGDEELYEACDKYGIMVWQDFWLANPWDGPDPDDNKMFLENSADYISRI
RNHASIGIYCGRNEGFPPAAIDKVLREQVKDIHPQLGYIPSSADLGVSGHGPYQMKSPSF
YFANQSHKLHSERGMPNVPTFESLSRMMEPEHLWPQSDAWGQHDYTLKGAQGGESFNNIM
EKRYGKPQSAEQFTKWAQWLNYDGYRAMYESSQQDRLGLLIWMSHACWPSMVWCTYDYYF
EPTAAYFGVKKACEPLHIQYNPVKKVAEVVNFAGGAKNGLVAKAQIFDMYGKLLKEESKE
VNVGEDQTVDAVSVSEPDEEVYYIKLSLEQNSQMISDNFYVQGKEEDNLQALSKLPKATV
AISGKRFVQQGEEWIGEVEIRNTGNVPALLIRLNLKGGDGEQILPVIYSDNYFSLMPDEC
KIIKVSYRDEDGRGQAPYVEITGFNK

Enzyme Prediction     

No EC number prediction in MGYG000000644_01978.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	365	1054	2.9e-78	0.7327127659574468
CBM32	234	347	6.9e-16	0.8145161290322581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.28e-34	373	815	17	426	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18368	Ig_GlcNase	3.79e-33	1058	1165	1	103	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
PRK10340	ebgA	7.92e-09	427	794	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00754	F5_F8_type_C	9.49e-08	237	346	21	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00703	Glyco_hydro_2	1.30e-07	554	669	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48125.1	0.0	26	1165	27	1174
QIX64986.1	0.0	26	1165	46	1205
AST55694.1	0.0	26	1165	46	1205
BBK93008.1	0.0	26	1165	46	1205
QKH99266.1	0.0	26	1165	46	1205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZO_A	4.76e-67	382	1165	78	890	Crystalstructure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZS_A	1.15e-66	382	1165	78	890	ChitosanProduct complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZT_A	1.54e-66	382	1165	78	890	Complexof Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	2.87e-65	382	1165	78	890	Complexof Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
2VJX_A	2.25e-47	375	1146	15	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5H7P5	4.84e-80	382	1165	35	944	Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum OX=4690 GN=EBM PE=1 SV=4
Q82NR8	1.49e-77	382	1165	79	895	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
Q75W54	3.65e-77	361	1165	18	935	Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana OX=3702 GN=EBM PE=1 SV=3
Q56F26	6.29e-66	382	1165	78	890	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
C0LRA7	1.86e-52	354	1165	14	882	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000641	0.998315	0.000310	0.000265	0.000239	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000644_01978.