CAZyme Information: MGYG000000646_01660

Basic Information

• Species: Eubacterium_R sp000436835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp000436835
• CAZyme ID: MGYG000000646_01660
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44119.96	5.0708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000646	2069247	MAG	Germany	Europe

• Gene Location: Start: 36804; End: 38000 Strand: +

Full Sequence      

MKKSVKIIILILAIVLIGAIVFDVTLVNNAKTGNEKNASTAQTVSKSTTKAEKTYSDPVE
AQAREMIKNMTLYEKVGQMLLYYIPKEEDPTRMMARWQFGGYILFSRNFENSTPAKTRSD
INDYQSAAKIPAFMAVDEEGGGVNRVSQYSQYRSEPFHSGITNYQKGGWQAVVDDAEDKS
EFMLDLGINTVLAPVADVPYSRSDYIYSRAFSTDADSVSEYVSKTVSTMNENNFLSCVKH
FPGYGNNTNTHTGMSVDNRSWESFEERDLKPFKAGIDAGVPFLMVSHNVIDDYDEGVPAS
LSKKLHNYIRKDMGYDGIILCDGLGMSGVRDYVGGDKGEVAVRAVMAGNDMLCATDVGVQ
LRAIVKAVKDGRIELSQIEDSVTRILMTKINYGLIEKE

Enzyme Prediction     

No EC number prediction in MGYG000000646_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	125	353	1.6e-44	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.27e-61	71	386	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	4.03e-58	70	397	1	320	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	4.66e-33	100	352	27	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.65e-19	56	394	26	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42693.1	6.26e-106	63	396	79	409
QNM02560.1	3.50e-101	59	395	85	418
QHQ63470.1	7.65e-98	60	396	82	415
BCJ98858.1	1.48e-96	57	396	122	458
BCI61427.1	2.36e-95	56	395	147	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.60e-37	63	394	35	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.33e-37	63	394	9	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.89e-37	63	394	39	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	3.57e-27	72	389	9	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.05e-26	68	389	9	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	8.73e-37	63	394	35	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q6LJ30	2.62e-23	100	352	27	271	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
Q82SJ8	1.54e-22	100	352	29	280	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
P48823	3.42e-22	70	389	16	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
C4LEY6	8.31e-22	100	371	27	289	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.495610	0.501553	0.001752	0.000295	0.000248	0.000532

TMHMM  Annotations     

start	end
7	26