CAZyme Information: MGYG000000648_01072

Basic Information

• Species: Collinsella aerofaciens_G
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_G
• CAZyme ID: MGYG000000648_01072
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34492.54	4.4188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000648	2024638	MAG	Germany	Europe

• Gene Location: Start: 15194; End: 16114 Strand: -

Full Sequence      

MKYWLTFNEINMILHLPFMGAGLVFEEGENREAVEYLAAHNELVASAWATKIAHEIDPEV
KIGCMLAAGTYYPYSCRPGDVRQAQLDNQDNYFFVDVQSRGYYPAYAVKKLERLGIDVGM
TDEDREILADNTVDFISFSYYSTRCSAGADNPDVEKTQGNAFAGAKNPYLQQSQWGWAID
PLGFRITLNDLYDRYQKPLFVVENGLGAKDVVEEDGSINDDYRIDYLRQHIAAMRDAVTE
DGVDLLGYTTWGPIDLVSAGTGEMSKRYGFIYVDRDDAGNGTLKRSKKKSFDWYKKVIAS
NGEDLA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	302	3.6e-79	0.627039627039627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	0.0	1	305	174	477	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	4.18e-175	1	306	172	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	6.22e-143	1	305	168	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	8.49e-134	2	304	161	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	4.07e-121	1	305	170	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	9.34e-222	2	306	172	476
ATP54514.1	1.40e-209	2	306	172	476
QWT17213.1	2.12e-180	2	305	172	474
AEB07701.1	9.14e-170	2	306	172	475
QIA32972.1	4.17e-166	2	305	172	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.12e-133	2	305	168	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	6.90e-114	2	305	173	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	2.10e-110	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	5.94e-110	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.15e-107	2	305	172	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.68e-141	2	305	173	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.30e-130	2	305	168	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	2.47e-118	2	305	165	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	3.78e-113	2	305	173	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	1.44e-111	2	305	167	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.866965	0.127981	0.004419	0.000207	0.000145	0.000293

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000648_01072.